PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04463-augustus-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family G2-like
Protein Properties Length: 369aa    MW: 40812.4 Da    PI: 9.024
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04463-augustus-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32247300255
                                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  maker-scaffold04463-augustus-gene-0.5-mRNA-1 247 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 300
                                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28245300IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-24247300IPR006447Myb domain, plants
PfamPF002496.3E-7248299IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPLDGIFIEP SSTPLPDLSL HISPPNPSSS SSSQICNTSN EVDTRRTTES QAHTELSLGR  60
NFTTPNPYQQ PRHLVHHHHH PNNRLNHMNH GVLDLSSDGL KPIKGIPVYQ HHRSFPFLPV  120
DQVHTTRDKE AKMCYYQMPS NNPSLCTSSS SVSHAHSSPY GGGLDAMSIL SSGPNASSLA  180
AAYNRLGTAT ATRFNGLSTD AFKSHQLHHH HHHNQYGVGP SEVPHGIGMM RSRFMPKLPT  240
KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT  300
VKTTDKPAAS SGQSDGSGED DISPIGSNSE LGLRHSYNDQ RGPSDHRPVQ QDHVLDYAST  360
TLWSNSSRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16248302357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16248302357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16248302357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16248302357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16248302458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023883806.10.0transcription repressor KAN1 isoform X1
RefseqXP_023883807.10.0transcription repressor KAN1 isoform X2
TrEMBLA0A2I4GT681e-145A0A2I4GT68_JUGRE; transcription repressor KAN1-like isoform X1
TrEMBLA0A2I4GT781e-145A0A2I4GT78_JUGRE; transcription repressor KAN1-like isoform X2
STRINGcassava4.1_008805m1e-138(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-56G2-like family protein