PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04399-augustus-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 404aa    MW: 45923.2 Da    PI: 6.2667
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04399-augustus-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM184.72.2e-57161431129
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdee++++yL++kv ++++++ ++i e+d++k+ePwdLpkk+k +ekewyfF++r
  maker-scaffold04399-augustus-gene-0.11-mRNA-1  16 LPPGFRFHPTDEEIITCYLTEKVVNSNFSA-SAIGEADLNKCEPWDLPKKAKMGEKEWYFFCQR 78 
                                                    79**************************99.88***************99999*********** PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    d+ky+tg r+nrat+sgyWkatgkdke+++ kg lvg+kktLvfykgrapkgekt+Wvmheyrl
  maker-scaffold04399-augustus-gene-0.11-mRNA-1  79 DRKYPTGMRTNRATESGYWKATGKDKEIYKGKGCLVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 142
                                                    ******************************9********************************8 PP

                                            NAM 129 e 129
                                                    e
  maker-scaffold04399-augustus-gene-0.11-mRNA-1 143 E 143
                                                    5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-6412180IPR003441NAC domain
PROSITE profilePS5100558.55816180IPR003441NAC domain
PfamPF023651.9E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MEEAIVVNKG EELIDLPPGF RFHPTDEEII TCYLTEKVVN SNFSASAIGE ADLNKCEPWD  60
LPKKAKMGEK EWYFFCQRDR KYPTGMRTNR ATESGYWKAT GKDKEIYKGK GCLVGMKKTL  120
VFYKGRAPKG EKTNWVMHEY RLEGKFSYYN LPKTAKDSKL NDIYCVLLQD EWVVCRIFHK  180
SNSGIKKSST PDGLLRMNSF GDDLLDISSL PPLMDPPFSD TNKPGYGDNN NFSFKGSSSY  240
FPNDQQQQQQ QQLKQQDQKL FQMPTNNYTS NTSYHNPIPN QGLYPQTQVP NQYPFNFPAN  300
PIQSGYLHQG RSTGTSSSIP SSNYGFGVNE QGILERQCKV EQFSSNQSMS MVSHSQDTGL  360
STADMNAEIS SLVSKQQDNR SYDDLIEGPS LGPIADFDRF NWDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-531418615171NO APICAL MERISTEM PROTEIN
1ut4_B3e-531418615171NO APICAL MERISTEM PROTEIN
1ut7_A3e-531418615171NO APICAL MERISTEM PROTEIN
1ut7_B3e-531418615171NO APICAL MERISTEM PROTEIN
3swm_A3e-531418618174NAC domain-containing protein 19
3swm_B3e-531418618174NAC domain-containing protein 19
3swm_C3e-531418618174NAC domain-containing protein 19
3swm_D3e-531418618174NAC domain-containing protein 19
3swp_A3e-531418618174NAC domain-containing protein 19
3swp_B3e-531418618174NAC domain-containing protein 19
3swp_C3e-531418618174NAC domain-containing protein 19
3swp_D3e-531418618174NAC domain-containing protein 19
4dul_A3e-531418615171NAC domain-containing protein 19
4dul_B3e-531418615171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023906757.10.0NAC domain-containing protein 87-like
SwissprotQ9FK441e-116NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A2N9IYK11e-179A0A2N9IYK1_FAGSY; Uncharacterized protein
STRINGVIT_08s0007g07640.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-108Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]