PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold04312-snap-gene-0.21-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 148aa    MW: 17365.6 Da    PI: 9.81
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold04312-snap-gene-0.21-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.46.1e-4591362128
                                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkk 67 
                                                 pG+rF+Ptd+el+++yLk k++g++++ +  i+e+diyk+ePwdLp  +++ +++k w+f + ++ k
  maker-scaffold04312-snap-gene-0.21-mRNA-1   9 LPGYRFSPTDDELIDDYLKLKITGNENKNTWRIPEIDIYKYEPWDLPnfARIPTKDKVWHFITAQSLK 76 
                                                59************************999777***************544888899************ PP

                                        NAM  68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                +++g+  nr+t++g+Wk+tgkd++++s +ge++g+kk+Lv++ gr+p+ge+t+W mheyr 
  maker-scaffold04312-snap-gene-0.21-mRNA-1  77 HKNGSSMNRSTQKGFWKSTGKDRKIKS-GGEVIGMKKSLVYHIGRSPNGERTEWKMHEYRT 136
                                                ***************************.*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100544.2638148IPR003441NAC domain
SuperFamilySSF1019413.01E-468141IPR003441NAC domain
PfamPF023651.6E-2310135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MDDPDLYSLP GYRFSPTDDE LIDDYLKLKI TGNENKNTWR IPEIDIYKYE PWDLPNFARI  60
PTKDKVWHFI TAQSLKHKNG SSMNRSTQKG FWKSTGKDRK IKSGGEVIGM KKSLVYHIGR  120
SPNGERTEWK MHEYRTTQKE FDGKHPGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-341013517139Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023913056.16e-95NAC domain containing protein 50-like isoform X1
RefseqXP_023913057.16e-95NAC domain containing protein 50-like isoform X2
SwissprotQ9LKG85e-48NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A2I4F9382e-53A0A2I4F938_JUGRE; LOW QUALITY PROTEIN: NAC domain-containing protein 91-like
STRINGEOY237341e-50(Theobroma cacao)
STRINGXP_004514021.11e-50(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.22e-50TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]