PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03566-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 230aa    MW: 25940.5 Da    PI: 7.8523
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03566-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32156214159
                                                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  maker-scaffold03566-snap-gene-0.12-mRNA-1 156 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 214
                                                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.2E-34141214IPR003657WRKY domain
SuperFamilySSF1182901.31E-28148214IPR003657WRKY domain
PROSITE profilePS5081129.585151213IPR003657WRKY domain
SMARTSM007746.3E-38156215IPR003657WRKY domain
PfamPF031063.1E-25157213IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MKIMEEERGA PNYELQVSFS ATPQAIHDMG FVQFEDNQVL SFLAPSQSSQ MSQPLSGGGA  60
TTNTTTTATT GGTSNTNPTT MGFSHNDLVT RPSWNNDQVG TMDPKAVNDE NGTGNASDGN  120
NSWWRSSTSD KSKVKVRRKL REPRFCFQTR SDVDVLDDGY KWRKYGQKVV KNSLHPRSYY  180
RCTHNNCRVK KRVERLSEDC RMVITTYEGR HNHSPCDDSN SSEHECFTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26147213874Probable WRKY transcription factor 4
2lex_A3e-26147213874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140KVRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515333.11e-128PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY42e-72WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A061DUM51e-127A0A061DUM5_THECC; WRKY family transcription factor
STRINGGLYMA07G13611.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72943245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-70WRKY family protein