PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03480-snap-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 205aa    MW: 22425.4 Da    PI: 7.5303
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03480-snap-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.51.3e-39101101100
                                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67 
                                                +C aCk+lrrkC+++Cv+apyf ++q +++fa+vhk+FGasn +kll ++p ++r da+ +l+yeA  
  maker-scaffold03480-snap-gene-0.20-mRNA-1  10 PCGACKFLRRKCVNGCVFAPYFDSDQgTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCYEALS 77 
                                                7***********************9989**************************************** PP

                                     DUF260  68 rardPvyGavgvilklqqqleqlkaelallkee 100
                                                r+rdPvyG+vg+i++lqqq+ +l+aela+++++
  maker-scaffold03480-snap-gene-0.20-mRNA-1  78 RVRDPVYGCVGHIFTLQQQVVNLQAELAYVQAR 110
                                                *****************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.9429111IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3810108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSASNNGGGP CGACKFLRRK CVNGCVFAPY FDSDQGTAHF AAVHKVFGAS NASKLLLRIP  60
AHKRLDAVVT LCYEALSRVR DPVYGCVGHI FTLQQQVVNL QAELAYVQAR ISTLQRLPPL  120
PPPQSQSPSP TNHHHCTSDL ATSSDLQHSL SMQFDPIQPQ PTSTELTSFF DPLAEELEDG  180
DVQVLARELI SRYLPGVRFR ASSPH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007052037.11e-106LOB domain-containing protein 31
SwissprotO813226e-75LBD31_ARATH; LOB domain-containing protein 31
TrEMBLA0A061DTV81e-106A0A061DTV8_THECC; LOB domain-containing protein 31
STRINGGLYMA03G02631.15e-87(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17713493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00210.15e-69LOB domain-containing protein 31