PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03404-augustus-gene-0.26-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family ARR-B
Protein Properties Length: 681aa    MW: 74507.5 Da    PI: 6.0166
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03404-augustus-gene-0.26-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-29213266155
                                        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                                    kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  maker-scaffold03404-augustus-gene-0.26-mRNA-1 213 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                                                    79*******************.********************************8 PP

2Response_reg731.2e-24351431109
                                                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHH CS
                                   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlell 62 
                                                    vl+vdD+p+ + +l+++l+   y ev+ +  +e al +l+e++  +D+++ D+ mp+mdG++ll
  maker-scaffold03404-augustus-gene-0.26-mRNA-1  35 VLVVDDDPTCLVILEKMLRTCLY-EVTKCNRAEVALSMLRENKngFDIVISDVHMPDMDGFKLL 97 
                                                    89*********************.***************999999******************* PP

                                                    HHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
                                   Response_reg  63 keireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                                                    ++i  e  +lp+i+++a + ++ + + +  Ga d+l Kp+ +e+l +
  maker-scaffold03404-augustus-gene-0.26-mRNA-1  98 EHIGLEM-DLPVIMMSADDGKQVVMKGVTHGACDYLIKPVRIEALKN 143
                                                    ***6654.8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-18215670IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23009.3E-4232182No hitNo description
SuperFamilySSF521721.85E-3432156IPR011006CheY-like superfamily
SMARTSM004483.2E-2933145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.15134149IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.2E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.93E-2636148No hitNo description
PROSITE profilePS5129411.048210269IPR017930Myb domain
SuperFamilySSF466893.58E-20210270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30212271IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25213266IPR006447Myb domain, plants
PfamPF002499.8E-8215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MNQSNCKGSM STASSSTNWK ANDVVPDQFP AGLRVLVVDD DPTCLVILEK MLRTCLYEVT  60
KCNRAEVALS MLRENKNGFD IVISDVHMPD MDGFKLLEHI GLEMDLPVIM MSADDGKQVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KKKNEWKDLE QSGSVEEGDR QQKLSEDVDY  180
SSSANEGNWK NSKKRKDEEE ETEERDDTST LKKPRVVWSV ELHQQFVAAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHQGM NNSFMSPQDA TFGAMSSLNG  300
LDLQTLSVTG QLPAQSLATL QAAGLGRSTT KSGIPMPLVD QRNLFSFENP KLRFGEGQQQ  360
QMSSNKPMNL LHGIPTTMEP KQLASLHQSA QSIGSMNMQV NTHGGQGSSL LMQMAQPQSR  420
GQILNESTSS HGPRLPSSIG QPTMTNGIAG GVIGRNGIGD NSRGTGYNQV PPSSSMLSFP  480
MNHTTELAGN SFPLGSSPGI SNVTSKGPFQ EEGNSEMKGS AGFISSYDIF NDLNQHQHKS  540
HDWELQNVGL HFDASQNANP IQGNLDVSPS VLVHQGYSSS QRSGQNRNAS AVGRAMFSGV  600
ECVEQGNMQN FSPHLNNLLV DNSIRVKAET IPDANSQTTL FTEHFGQDDL MSALLKQQQG  660
GIGTAETDFD LDGYSMDNIP V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22212272464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023916952.10.0two-component response regulator ARR2-like isoform X1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A2N9EZG90.0A0A2N9EZG9_FAGSY; Two-component response regulator
STRINGEOY066390.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]