PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03354-snap-gene-0.28-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 516aa    MW: 56831.1 Da    PI: 8.2239
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03354-snap-gene-0.28-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.66e-34222278259
                                                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                +DgynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkvers  +++++ei+Y+g+Hnhe
  maker-scaffold03354-snap-gene-0.28-mRNA-1 222 NDGYNWRKYGQKQVKGSEFPRSYYKCTHLNCPVKKKVERSP-EGQITEIIYKGQHNHE 278
                                                8****************************************.***************7 PP

2WRKY106.21.6e-33407465159
                                                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                ldDgy+WrKYGqK+vkg+++prsYY+Cts gC+v+k+ver+++dpk+v++tYeg+Hnh+
  maker-scaffold03354-snap-gene-0.28-mRNA-1 407 LDDGYRWRKYGQKVVKGNPHPRSYYKCTSVGCNVRKHVERASTDPKAVITTYEGKHNHD 465
                                                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.2E-29214280IPR003657WRKY domain
PROSITE profilePS5081123.376216280IPR003657WRKY domain
SuperFamilySSF1182902.62E-26219280IPR003657WRKY domain
SMARTSM007745.3E-37221279IPR003657WRKY domain
PfamPF031064.2E-26222278IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-37392467IPR003657WRKY domain
SuperFamilySSF1182901.7E-29399467IPR003657WRKY domain
PROSITE profilePS5081138.916402467IPR003657WRKY domain
SMARTSM007741.6E-39407466IPR003657WRKY domain
PfamPF031064.9E-26408465IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MAKSEDSERV TAPRPTITLP PRPSMETFFT GGPGASPGPM TLVSSFFSDN YPDSDCRSFS  60
QLLAGAMASP LATPTFFTHK DNSLKDNTSG FKQSRPTNLV VASSPLFTIP PGLSPSGFLN  120
SPGFFSPQSP FGMSHQQALA QVTAQAALVQ SHMNMQAEYQ PSTLAASTES LTHNPSFTLS  180
EASRQQMAPS TSDPRNSMME QSEASHSDRK YQPTIAVDKP TNDGYNWRKY GQKQVKGSEF  240
PRSYYKCTHL NCPVKKKVER SPEGQITEII YKGQHNHELP QPNKRAKEGS DLSGNTNSQA  300
KPDLGLQNQA GNWNKSSQVV PAYTVPERDQ ESTQTAPTQL TGSSDSEEEG DAETREEGGG  360
DEPNPKRRHI PNLLSMTDAG TSEVPLSHKT VTEPKIIVQT RSEVDLLDDG YRWRKYGQKV  420
VKGNPHPRSY YKCTSVGCNV RKHVERASTD PKAVITTYEG KHNHDVPAAR SSSHNTANRI  480
APQKVVTEKH PLLKEMNFES SDQRPVLLQL KEEKIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-40222468878Probable WRKY transcription factor 4
1wj2_A1e-40222468878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230819.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-155WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLS4VDR50.0S4VDR5_9R
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-137WRKY DNA-binding protein 3