PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03032-augustus-gene-0.24-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 309aa    MW: 35899.1 Da    PI: 6.573
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03032-augustus-gene-0.24-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM125.35e-391985106
                                            NAM   5 frFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkky 68 
                                                    frFhPtdeelv++yL+kk+++k+++l +vik+vd+yk+ePwdL+   +++++ewyfFs++dkky
  maker-scaffold03032-augustus-gene-0.24-mRNA-1   1 FRFHPTDEELVDYYLRKKIAAKRIDL-DVIKDVDLYKIEPWDLQ--GTEDQNEWYFFSHKDKKY 61 
                                                    8*************************.9***************8..345788************ PP

                                            NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktL 106
                                                    +tg+r+nratk+g+Wkatg+dk++++ +++l+g++ktL
  maker-scaffold03032-augustus-gene-0.24-mRNA-1  62 PTGTRTNRATKAGFWKATGRDKAIYA-RHSLIGMRKTL 98 
                                                    **************************.8899******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.5041149IPR003441NAC domain
PfamPF023652.1E-17199IPR003441NAC domain
SuperFamilySSF1019411.44E-391110IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
FRFHPTDEEL VDYYLRKKIA AKRIDLDVIK DVDLYKIEPW DLQGTEDQNE WYFFSHKDKK  60
YPTGTRTNRA TKAGFWKATG RDKAIYARHS LIGMRKTLEE GWVVCRVFKK RMAAVRKMGD  120
YESPCWYEEP VSFMPELDSP RRVSHPYTPY HHHYPCKQEL ELQYSMNMPH DPNFLQLPQL  180
ESPKVPQSGA SLSCTSVVPY GFDRNSNGSA LQSSTLTQEE HMQQSHLSSF YSNNEAVDQV  240
TDWRVLDKFV ASQLSHDQDA SKETNYSNAQ GVFHVSEHMN MLSNDSKRPE ITEEFASTSA  300
SSCQIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-3019819118Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358653e-43AC235865.2 Glycine max clone GM_WBb0117N07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023876552.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-110NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A2N9ECQ00.0A0A2N9ECQ0_FAGSY; Uncharacterized protein
STRINGVIT_02s0154g00020.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-111NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]