PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03016-augustus-gene-0.16-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 343aa    MW: 39004.6 Da    PI: 4.5551
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03016-augustus-gene-0.16-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.2e-5661331128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFs 62 
                                                    lppGfrFhPtdeelv +yL++k++g ++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s
  maker-scaffold03016-augustus-gene-0.16-mRNA-1   6 LPPGFRFHPTDEELVAYYLHRKINGGTIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDMEWYFYS 68 
                                                    79****************************.99**************95345556888****** PP

                                            NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmhey 126
                                                    +rd+ky++g+r+nrat++gyWkatgkd++v+s +++ vg+kktLv+y+grap+g +t+Wvmhey
  maker-scaffold03016-augustus-gene-0.16-mRNA-1  69 PRDRKYPNGSRTNRATRAGYWKATGKDRPVHS-HKHPVGMKKTLVYYRGRAPHGIRTNWVMHEY 131
                                                    ********************************.999**************************** PP

                                            NAM 127 rl 128
                                                    rl
  maker-scaffold03016-augustus-gene-0.16-mRNA-1 132 RL 133
                                                    98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-643158IPR003441NAC domain
PROSITE profilePS5100560.2876158IPR003441NAC domain
PfamPF023655.0E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLHRKING GTIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRPVHS HKHPVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLIDSMCSS SASSSLKDSY ALCRIFKKTI QIPKAKEKEQ TENLENGNPV  180
SALDEQLLGD DTSGLETFQG REAEDENFIQ DYSKFPSDTS SSDLTQGTPA ETGIADDLQA  240
PFASDEANSA ANLYSLGVDY PSNLIQDMQI QSYTSLDYQL PYPPLELEDF PQINLTETKP  300
VKPEIIDEYM SYDKIRDCMN GTLEEIFSLC SSLDNPVALS LQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-58115812165NO APICAL MERISTEM PROTEIN
1ut4_B5e-58115812165NO APICAL MERISTEM PROTEIN
1ut7_A5e-58115812165NO APICAL MERISTEM PROTEIN
1ut7_B5e-58115812165NO APICAL MERISTEM PROTEIN
3swm_A5e-58115815168NAC domain-containing protein 19
3swm_B5e-58115815168NAC domain-containing protein 19
3swm_C5e-58115815168NAC domain-containing protein 19
3swm_D5e-58115815168NAC domain-containing protein 19
3swp_A5e-58115815168NAC domain-containing protein 19
3swp_B5e-58115815168NAC domain-containing protein 19
3swp_C5e-58115815168NAC domain-containing protein 19
3swp_D5e-58115815168NAC domain-containing protein 19
4dul_A5e-58115812165NAC domain-containing protein 19
4dul_B5e-58115812165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023895289.10.0NAC domain-containing protein 86-like
RefseqXP_023895294.10.0NAC domain-containing protein 86-like
SwissprotQ9FFI56e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0M4G3Q60.0A0A0M4G3Q6_MANES; NAC transcription factors 56
STRINGcassava4.1_024467m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-108NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]