PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02975-augustus-gene-0.24-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 677aa    MW: 73458.9 Da    PI: 6.4616
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02975-augustus-gene-0.24-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31244300259
                                                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    +D ynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  d++++ei+Y+g+Hnh 
  maker-scaffold02975-augustus-gene-0.24-mRNA-1 244 EDVYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSY-DGQITEIIYKGTHNHA 300
                                                    7****************************************.***************7 PP

2WRKY1023.5e-32460518159
                                                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+a++ k+v++tYeg+Hnhe
  maker-scaffold02975-augustus-gene-0.24-mRNA-1 460 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERAAHNLKCVITTYEGKHNHE 518
                                                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-27236302IPR003657WRKY domain
PROSITE profilePS5081123.032238302IPR003657WRKY domain
SuperFamilySSF1182909.15E-25240302IPR003657WRKY domain
SMARTSM007741.4E-33243301IPR003657WRKY domain
PfamPF031061.1E-23244299IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-35445520IPR003657WRKY domain
SuperFamilySSF1182901.14E-27453520IPR003657WRKY domain
PROSITE profilePS5081137.252455520IPR003657WRKY domain
SMARTSM007742.8E-36460519IPR003657WRKY domain
PfamPF031062.0E-24461518IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MEEEECKSGS KSIAERRAAK CGFNAQSLNK TALFRTATPL ASSSPAARSP RLTIPPGISP  60
AALLDSPIML PNTQVLPSPT TGTFPLVPLN HDSSMLSSLT AEDGGRCSGV GSSFKFMPYG  120
DPNFPSRFSS FQEQVSIDCN IVQGASVDYQ ALVSMQTPMD FEFPEELPKA DVTKNCAADV  180
PTEMKMVKNM IMNANLKIHC PEVAGDQKSL TKEPIHGGDI GTNHFVEGDQ KGPCPSTGTE  240
RTSEDVYNWR KYGQKQVKGS EYPRSYYKCT HPNCQVKKKV ERSYDGQITE IIYKGTHNHA  300
KPQPNRRAFP GSACSIDETS MMGEGSGTCK VEGESIWRSI QSGSKDIKLG SDWRNDGVEG  360
TSSASVVSEL SDPISTTHGR SVGVFESADT PDLSSTLASH DDHEDGATQG SISLGEDAED  420
DESESKRRKT DSCLIETNLA SRAVREPRVV VQIESDVDIL DDGYRWRKYG QKVVKGNPNP  480
RSYYKCTSAG CSVRKHVERA AHNLKCVITT YEGKHNHEVP AARNSGQINS NGGNAPPAAA  540
NAQPALTLPR HPNVLKSETQ VQDLAPHFDR KPEFNNDYLS SSFLGNFNND MKFGASSIYQ  600
MKFPPLQNTM PYASLGLNSN CNVTHQAGSI ASVLPNFPIS LPLNLPQAGL AGFDFKNGKP  660
IGSVESFLSG QQPKEND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-34232521178Probable WRKY transcription factor 4
1wj2_A5e-34232521178Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150374e-35AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015875770.10.0PREDICTED: WRKY transcription factor SUSIBA2-like
TrEMBLM5WG220.0M5WG22_PRUPE; Uncharacterized protein (Fragment)
STRINGGLYMA09G38581.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-105WRKY DNA-binding protein 2