PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02951-augustus-gene-0.25-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Trihelix
Protein Properties Length: 285aa    MW: 33910.2 Da    PI: 8.1505
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02951-augustus-gene-0.25-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.83.9e-2536118186
                                       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykki 64 
                                                    +W+ qe+++ + +r e+++++ ++k++k lWe +s km+e+gf+rs++qCk+kw+nl +ryk +
  maker-scaffold02951-augustus-gene-0.25-mRNA-1  36 QWSVQETKEFLMIRAELDRTFMETKRNKLLWEVISTKMKEKGFNRSAEQCKCKWKNLVTRYKGC 99 
                                                    7*************************************************************** PP

                                       trihelix  65 kegekkrtsessstcpyfdqle 86 
                                                    +++e +     ++++p++++l+
  maker-scaffold02951-augustus-gene-0.25-mRNA-1 100 ETMEPEA---MRQQFPFYNELQ 118
                                                    *****95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.8E-43395IPR001005SANT/Myb domain
CDDcd122031.26E-2335100No hitNo description
PfamPF138371.5E-2036120No hitNo description
PROSITE profilePS500907.3173793IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEGHHPHPHP HHLQHQHQQQ QHHISVNVDT SDRFPQWSVQ ETKEFLMIRA ELDRTFMETK  60
RNKLLWEVIS TKMKEKGFNR SAEQCKCKWK NLVTRYKGCE TMEPEAMRQQ FPFYNELQAI  120
FTARMQRMLW AEAEGAASGS KKKAAQLSSD EEEDIEDSEG EIKGNTRKKI KKSSKNNITG  180
SSTSGAGSGS GNNFNHLKEI LDDFMKQQLQ IEVQWREAFE ARENERRLKE MEWRQHMEAL  240
ENERILMEQR WREREEQRRM REEARAEKRD ALITALLSKI RREDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1233116386DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1277681e-54JN127768.1 Theobroma cacao clone TCC_BC011L18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308224.11e-128hypothetical protein POPTR_0006s10240g
SwissprotQ9SDW04e-75TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9HCX71e-128B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.19e-55Trihelix family protein