PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02896-snap-gene-0.29-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 291aa    MW: 32416.7 Da    PI: 10.1302
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02896-snap-gene-0.29-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-132266147
                                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                               r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  maker-scaffold02896-snap-gene-0.29-mRNA-1 22 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 66
                                               789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171672IPR009057Homeodomain-like
PROSITE profilePS5129415.4081771IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-72072IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-182069IPR006447Myb domain, plants
SMARTSM007175.3E-112169IPR001005SANT/Myb domain
PfamPF002492.3E-112266IPR001005SANT/Myb domain
CDDcd001671.52E-82467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MPPILSLRVS QIRKPYTITK SRESWTEQEH DKFLEALQLF DRDWKKIEAF VGSKTVIQIR  60
SHAQKYFLKV QKSGASEHVP PPRPKRKAAH PYPQKAPKNA PVISQATGQY QSSPVMLEPA  120
SYVYRPDSSS VLGNPMNSST VSSWSFNSVP PVTVSQATKG LAGPTISQNC CYSSSNESMP  180
KTRPTGEKIN RGDHGSTARV MPDFAQVYGF IGSVFDPNST GHLQRLKQMD RINLETVLLL  240
MRNLSVNLTS PEFEDHRRLL SSYDADPEKA KSGRPHTNSH IDHSQSAILS A
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023874181.10.0protein REVEILLE 5
SwissprotQ8H0W31e-103RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2I4G0071e-153A0A2I4G007_JUGRE; protein REVEILLE 5 isoform X2
STRINGEOX958711e-153(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-87MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]