PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02829-snap-gene-0.27-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 516aa    MW: 58553.1 Da    PI: 4.826
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02829-snap-gene-0.27-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.42.6e-48131401128
                                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdk 66 
                                                lppGfrFhPtd el+++yLk+kv g + ++ +vi+e+d+yk+ PwdLp  ++++++++ewyfF++r+k
  maker-scaffold02829-snap-gene-0.27-mRNA-1  13 LPPGFRFHPTDVELLNYYLKRKVIGAPSHF-QVISELDLYKYSPWDLPgrSQYQSSDNEWYFFCPRNK 79 
                                                79*************************988.99***************6447888999********** PP

                                        NAM  67 kyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                k+a+g++ nra + gyWk +g+d+++ + ++++ g+kk+Lvfy+gr p+g +t+Wvmheyrl
  maker-scaffold02829-snap-gene-0.27-mRNA-1  80 KHANGSKINRANEFGYWKVSGRDRTISH-GEQNLGMKKILVFYTGRPPRGARTSWVMHEYRL 140
                                                ***************************9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-565161IPR003441NAC domain
PROSITE profilePS5100555.7513161IPR003441NAC domain
PfamPF023651.4E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MPAVSNSMEN TFLPPGFRFH PTDVELLNYY LKRKVIGAPS HFQVISELDL YKYSPWDLPG  60
RSQYQSSDNE WYFFCPRNKK HANGSKINRA NEFGYWKVSG RDRTISHGEQ NLGMKKILVF  120
YTGRPPRGAR TSWVMHEYRL LDKDLDIDIQ DLYVLCRVIY KSGVQSGTPL NQENWGSCHD  180
DMLNNAAFES SQLPNQPPSQ HVMSDDDQNM SMVMKSMPVD TNAFSSSIEA FPILTESSRE  240
FTFSLEGDNN LTKVEETTWP VNNNNKNEDL FNFNQSEYEA PPSWDGCDIF KDLEDLGFLA  300
ELNNINGHYI CNSQAADCVT DQMLLEQNEF LRAAKESEID PNRGFGVHYS ERLYDPILDI  360
PTPQSIDGEP MILQEPHWSH EPLDMSSKLN NNFEVTKINE DEVLSYSPPT APRELHKEYE  420
SFSVTESGTQ SAIHSSLQSL LESIPASHAS AVENPVHNSG WSLEVQPLDK LLQINGSSKH  480
ASPTHNFQML NQPWKRASRG KGYKFVAGLV VLSGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-451316117165NO APICAL MERISTEM PROTEIN
1ut4_B5e-451316117165NO APICAL MERISTEM PROTEIN
1ut7_A5e-451316117165NO APICAL MERISTEM PROTEIN
1ut7_B5e-451316117165NO APICAL MERISTEM PROTEIN
3swm_A5e-451316120168NAC domain-containing protein 19
3swm_B5e-451316120168NAC domain-containing protein 19
3swm_C5e-451316120168NAC domain-containing protein 19
3swm_D5e-451316120168NAC domain-containing protein 19
3swp_A5e-451316120168NAC domain-containing protein 19
3swp_B5e-451316120168NAC domain-containing protein 19
3swp_C5e-451316120168NAC domain-containing protein 19
3swp_D5e-451316120168NAC domain-containing protein 19
4dul_A5e-451316117165NAC domain-containing protein 19
4dul_B5e-451316117165NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023882990.10.0uncharacterized protein LOC111995304
TrEMBLA0A2N9IAY91e-150A0A2N9IAY9_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-55NAC domain containing protein 2