PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02799-augustus-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 403aa    MW: 45043.8 Da    PI: 5.7012
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02799-augustus-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM38.14.7e-125413432128
                                            NAM  32 evikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                                                    + +++vd ++++P++Lp        +++f ++++           + ++g W+ +g+  +++  
  maker-scaffold02799-augustus-gene-0.20-mRNA-1  54 NLLTNVDFLRCDPEHLP-------PDMWFLINSEVD--------GVNEHGKWSIKGEAYKIVL- 101
                                                    45888899999999998.......233444443332........2456899************. PP

                                            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    ++ ++  ++t+ fykg+ p+ ++t+Wvmheyr+
  maker-scaffold02799-augustus-gene-0.20-mRNA-1 102 DSMTTCSRTTFEFYKGQGPHKRRTSWVMHEYRI 134
                                                    9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.93225157IPR003441NAC domain
SuperFamilySSF1019412.22E-1748156IPR003441NAC domain
PfamPF023659.0E-658134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MQGQIQVADL FPFLLNCLTM CPPAVPSDIE SNLTAEIIKC LCKINKGDLD LPSNLLTNVD  60
FLRCDPEHLP PDMWFLINSE VDGVNEHGKW SIKGEAYKIV LDSMTTCSRT TFEFYKGQGP  120
HKRRTSWVMH EYRILQRGQF EGSNMKETNS LCRVLRDGKQ SQNHEKQLKL GSTNTASENH  180
IHTTHSVVPN ADNSIGQSST SQPRVCQPQL PGLHIWASED DDIVMLGLEH QHQNLHEIDH  240
PPEGDFLEMM DLLDEPASPS SSESSCVTMS SDECFDSLAL LQELEAENNQ NDAGCKFNVS  300
APVKPNEVKV FPASTGSLDR DREKMLTPSA ILKTDSSTPE SAVRCQVNRI QRPNFGNEGP  360
SSNSQNVTPP FSGHNRLAAD KEKMAHVGKK KKCWKYLLCF MSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023913941.11e-177uncharacterized protein LOC112025493 isoform X1
TrEMBLA0A2N9H5G71e-123A0A2N9H5G7_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-14NAC domain containing protein 28