PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02688-augustus-gene-0.23-mRNA-1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 290aa    MW: 32706.4 Da    PI: 5.293
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02688-augustus-gene-0.23-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    aCaaCk++rrkC+++C+l+ yfp eqpk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+
                                                    7*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkeel 101
                                                    A++r + PvyG+ g+i +lq q+ q+++el++++++l
  maker-scaffold02688-augustus-gene-0.23-mRNA-1  74 ANIRDKFPVYGCWGIICQLQYQILQAEEELHAVHAQL 110
                                                    ********************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7559110IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-3061137114LOB family transfactor Ramosa2.1
5ly0_B6e-3061137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023905851.10.0LOB domain-containing protein 27
TrEMBLA0A2N9GVD70.0A0A2N9GVD7_FAGSY; Uncharacterized protein
STRINGcassava4.1_033210m1e-162(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-60LOB domain-containing protein 27