PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02688-augustus-gene-0.23-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 290aa    MW: 32706.4 Da    PI: 5.293
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02688-augustus-gene-0.23-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-38101101101
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    aCaaCk++rrkC+++C+l+ yfp eqpk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+
  maker-scaffold02688-augustus-gene-0.23-mRNA-1  10 ACAACKYQRRKCSSECPLSLYFPPEQPKMFQNAHKLFGVSNILKILKNLQPCQKAEAMRSIIYQ 73 
                                                    7*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkeel 101
                                                    A++r + PvyG+ g+i +lq q+ q+++el++++++l
  maker-scaffold02688-augustus-gene-0.23-mRNA-1  74 ANIRDKFPVYGCWGIICQLQYQILQAEEELHAVHAQL 110
                                                    ********************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7559110IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRK CSSECPLSLY FPPEQPKMFQ NAHKLFGVSN ILKILKNLQP  60
CQKAEAMRSI IYQANIRDKF PVYGCWGIIC QLQYQILQAE EELHAVHAQL EMYRQHQHQI  120
SSLPDDMAAS QLELGMAPPS TNALSLFNHT PQPYNAVDAL PVTQQQHSYW NSNKAAYNSG  180
YMDTKDNVGN SFWVQHSYAN NDNNSNNSLA IQSELVSSQP LAIQHEVVQD YDEIHPFFDT  240
IDDRQSYIDS KEPFESSSEE SLKDTTQSVE HVAENELKSA AACFSLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-3061137114LOB family transfactor Ramosa2.1
5ly0_B6e-3061137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023905851.10.0LOB domain-containing protein 27
TrEMBLA0A2N9GVD70.0A0A2N9GVD7_FAGSY; Uncharacterized protein
STRINGcassava4.1_033210m1e-162(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-60LOB domain-containing protein 27