PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02433-augustus-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 332aa    MW: 37368.7 Da    PI: 8.4169
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02433-augustus-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51141391128
                                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrd 65 
                                                   lppGfrF Ptdeel+v+yL++kv+g++++l ++i e+d+yk++Pw Lp+k+  +ekewyfFs+rd
  maker-scaffold02433-augustus-gene-0.7-mRNA-1  14 LPPGFRFFPTDEELLVQYLCRKVAGHHFNL-QIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRD 77 
                                                   79****************************.89***************7777799********** PP

                                           NAM  66 kkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                   +ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  maker-scaffold02433-augustus-gene-0.7-mRNA-1  78 RKYPNGSRPNRVAGSGYWKATGTDKVITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                                                   ***************************99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6510163IPR003441NAC domain
PROSITE profilePS5100559.74714162IPR003441NAC domain
PfamPF023658.5E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF FPTDEELLVQ YLCRKVAGHH FNLQIIGEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLL EHSRKSGSTK LDDWVLCRIY KKNSSAQKPM TSVSTSSKEQ  180
SNDSSSSSHL DDMLDSSFPE INDRFFALPR VNSLKNFQND DKLSFQNLGS GNFDWASLAG  240
LNSVPEFAVE NQAHQAQTQG IVNYNGNDVY VPSIPQLCHV DEEVQSGLRT NSGMFQQNSN  300
SNSNVLTQNY SNSPDPFGFR YPTQSGGFGF RP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11111684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11111684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11111687174NAC domain-containing protein 19
3swm_B1e-11111687174NAC domain-containing protein 19
3swm_C1e-11111687174NAC domain-containing protein 19
3swm_D1e-11111687174NAC domain-containing protein 19
3swp_A1e-11111687174NAC domain-containing protein 19
3swp_B1e-11111687174NAC domain-containing protein 19
3swp_C1e-11111687174NAC domain-containing protein 19
3swp_D1e-11111687174NAC domain-containing protein 19
4dul_A1e-11111684171NAC domain-containing protein 19
4dul_B1e-11111684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLK0226953e-87LK022695.1 Fagus sylvatica partial nac gene for NAC transcription factor, exons 1-3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023910542.10.0NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-151JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A2N9G8X50.0A0A2N9G8X5_FAGSY; Uncharacterized protein
STRINGXP_010089503.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-129NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]