PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02307-augustus-gene-0.31-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 344aa    MW: 38785.5 Da    PI: 4.6635
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02307-augustus-gene-0.31-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.6e-09278325653
                                                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                                       Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                                                    +++k q+e+Le+++ +++ p+ +++    + ++L+ ++V  WF  +Ra
  maker-scaffold02307-augustus-gene-0.31-mRNA-1 278 RLKKVQVETLERVYGRTKRPTNAMISSVVHVTNLPRKRVVKWFEDKRA 325
                                                    57899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.345270330IPR001356Homeobox domain
SuperFamilySSF466891.11E-8272328IPR009057Homeodomain-like
CDDcd000864.71E-7273325No hitNo description
SMARTSM003891.8E-4276334IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-8278326IPR009057Homeodomain-like
PfamPF000461.8E-6278325IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGFALSAQSS IMALQIECFS SSLSDRLLVG HPSRPIHLNL PRFPPSRRSV LALARRRNPT  60
SPSSSKKNKK SLRHKEPAKE DDIDEDAYEA LFSQLEEDLK NEDPSLDDGD DEISEEDLAI  120
LVQELAEALG DDDILMSDSS ADDTESGNIA EEDEDKEEEE EEEEEEEERP VKLRNWQLRR  180
LASALKAGRR KTSIKNLAAE LCLDRAVVLE LLRDPPPNLL MMSAALPDEP APTVSLSVLE  240
PKPMETTHSE PSVHTEESGT KLQVPVHVMQ HKWSAQKRLK KVQVETLERV YGRTKRPTNA  300
MISSVVHVTN LPRKRVVKWF EDKRAEDGVP DEHPPYQRSV PETV
Functional Description ? help Back to Top
Source Description
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1508684e-95KC150868.1 Quercus ilex overexpressor of cationic peroxidase 3 (OCP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023915624.10.0protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 isoform X1
SwissprotQ8H0V52e-76OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLA0A2N9GLN91e-157A0A2N9GLN9_FAGSY; Uncharacterized protein
STRINGVIT_04s0008g05190.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.19e-74overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. García-Andrade J,Ramírez V,López A,Vera P
    Mediated plastid RNA editing in plant immunity.
    PLoS Pathog., 2013. 9(10): p. e1003713
    [PMID:24204264]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gamir J,Pastor V,Kaever A,Cerezo M,Flors V
    Targeting novel chemical and constitutive primed metabolites against Plectosphaerella cucumerina.
    Plant J., 2014. 78(2): p. 227-40
    [PMID:24506441]