PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02306-augustus-gene-0.21-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 346aa    MW: 38427.4 Da    PI: 8.5618
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02306-augustus-gene-0.21-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.1e-53121391128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +++ewyfFs+r
  maker-scaffold02306-augustus-gene-0.21-mRNA-1  12 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-SIIAEVDLYKFDPWELPAKATFGQHEWYFFSPR 74 
                                                    79****************************.89***************9888999********* PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyr 127
                                                    d+ky++g r+nra++sgyWkatg+dk+vls+ ++++vg+kk Lvfy g+ pkg kt+W+mheyr
  maker-scaffold02306-augustus-gene-0.21-mRNA-1  75 DRKYPNGARPNRAATSGYWKATGTDKPVLSSgSTQKVGVKKALVFYGGKPPKGIKTNWIMHEYR 138
                                                    ******************************967788***************************9 PP

                                            NAM 128 l 128
                                                    l
  maker-scaffold02306-augustus-gene-0.21-mRNA-1 139 L 139
                                                    8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-654173IPR003441NAC domain
PROSITE profilePS5100561.56512173IPR003441NAC domain
PfamPF023652.9E-2813139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MESTEMSQQP NLPPGFRFHP TDEELVVHYL KKKATSAPLP VSIIAEVDLY KFDPWELPAK  60
ATFGQHEWYF FSPRDRKYPN GARPNRAATS GYWKATGTDK PVLSSGSTQK VGVKKALVFY  120
GGKPPKGIKT NWIMHEYRLI DNKPNNKPPG CDLANKKNSL RLDDWVLCRI YKKNNTHRPM  180
DHEREDSMDD MTGPIAPSIS VSQQNMKLQF PKAGTSYGSL LDQNLFEGMV SNDGINSAMS  240
TQLASSSSMV PALGISNNFN MKRTLPSLYW NIDEEPSGPS SSKRLALDDS DESVTRTDGN  300
ASNSIASLLC QLPQTPSLHQ QAMLGSVGDI SLFRGPCHLP GLNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-741117514170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023910561.10.0NAC transcription factor 56-like
SwissprotQ9LD441e-123NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A2N9G8L40.0A0A2N9G8L4_FAGSY; Uncharacterized protein
STRINGEOY128520.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-123NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]