PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01919-snap-gene-0.23-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 588aa    MW: 64217.1 Da    PI: 8.1836
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01919-snap-gene-0.23-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.3e-32230287260
                                                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                                dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  maker-scaffold01919-snap-gene-0.23-mRNA-1 230 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 287
                                                8****************************************.***************85 PP

2WRKY106.21.7e-33403461159
                                                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  maker-scaffold01919-snap-gene-0.23-mRNA-1 403 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 461
                                                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.089224288IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-27225288IPR003657WRKY domain
SuperFamilySSF1182903.27E-25226288IPR003657WRKY domain
SMARTSM007742.5E-34229287IPR003657WRKY domain
PfamPF031061.1E-24230286IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37388463IPR003657WRKY domain
SuperFamilySSF1182902.35E-29395463IPR003657WRKY domain
PROSITE profilePS5081138.825398463IPR003657WRKY domain
SMARTSM007743.1E-39403462IPR003657WRKY domain
PfamPF031063.6E-26404461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MELRLLTATT STSTSTSSNN TSSSADVAAP PEDPTRNNDT TASAAAAAAA NARYKMMSPA  60
KLPISRLVFH MRKWVFNFKA EPSPTTGSFM KTHMMHGPVG STNPVTTVFS NTNIFNERNS  120
SCFEFKPHAS SNMVPADLNQ QRSEQSVQAQ GQCQPQAFAS SPSVKKEMAV SSNELSLASP  180
GHMVTSGAIV PVEVDTDEPN HRGTSNTGVQ ASQFDHKGSG PSVIAERPSD DGYNWRKYGQ  240
KLVKGSEFPR SYYKCTHPNC EVKKLFERSH DGQITEIIYK GTHDHPKPQP SRRYTAGAIM  300
AVQEERSDKA LSLNGRDERS GMFGQTSHTV EPNSTPDRSP VAVNDDSLDG GSMPNRIHDE  360
ADDDDPFSKR RKMDIGGADV TSVVKPIREP RVVVQTLSEV DILDDGYRWR KYGQKVVRGN  420
PNPRSYYKCT NAGCPVRKHV ERASHDPKAV ITTYEGKHNH DVPTARTSSH DTAGPTAVSG  480
PLRIRSEEND NVSLDLGVGI NSAVENRSNE HRQTHHSDIR GSQIHASSSH YNVVQATPVM  540
TYFGVLNTGM SQYGSRGNPS ESLNIGIPPL NHSSYPFPQN MGKILTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-37230463877Probable WRKY transcription factor 4
2lex_A4e-37230463877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214669.10.0hypothetical protein PRUPE_ppa003305mg
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01720.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein