PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01834-snap-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family G2-like
Protein Properties Length: 406aa    MW: 45390.4 Da    PI: 7.1519
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01834-snap-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32224277255
                                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  maker-scaffold01834-snap-gene-0.12-mRNA-1 224 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 277
                                                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15221278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-29222278IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-24224277IPR006447Myb domain, plants
PfamPF002495.8E-7225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSRKEIFEEP SLHQIPDLSL HISPPNSAPS SICTGTNDAD SSLDIWRKDE SLKSYSDGSI  60
RDTELSLSNP INDLEAESRW RRNFSSGSGE EVQARHIINH GISLLDVPDG VKAIKGIPVY  120
NNNNNYSFPF STLDHFKEMD PKFCFNQMAY PSSSSSPSFR ACGIGGFEPM SRYNGITMET  180
LRPQQIQYLQ QQPQYGVGAS DFPNGFMRSR FMSKLPSKRN MRAPRMRWTS SLHARFVHAV  240
ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKN TDKAAASSDG SGDEDNFLNT  300
TPAPHQNENC LLNQRRASNA ALEHEIGYPS NLWSNPSSGG AWVQASSRNM DRLRLETLPF  360
QQRSGNQFEG SDDSAQSKNS KGSSLNPKNP SLEFTLGRPD WQSKEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-17225279357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17225279357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17225279357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17225279357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-17225279458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023929357.10.0transcription repressor KAN1-like
TrEMBLA0A2I4G0251e-177A0A2I4G025_JUGRE; transcription repressor KAN1-like
STRINGEOY214941e-143(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-61G2-like family protein