PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01816-augustus-gene-0.19-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 321aa    MW: 36354.2 Da    PI: 8.0666
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01816-augustus-gene-0.19-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.6e-33185242259
                                                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+ver+ +dp++v++tYeg+Hnh+
  maker-scaffold01816-augustus-gene-0.19-mRNA-1 185 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCTVKKRVERNFQDPSIVITTYEGQHNHQ 242
                                                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-35169244IPR003657WRKY domain
SuperFamilySSF1182904.58E-29177244IPR003657WRKY domain
PROSITE profilePS5081132.386179244IPR003657WRKY domain
SMARTSM007741.5E-38184243IPR003657WRKY domain
PfamPF031063.9E-26185242IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSEEKKDLYH QDPFFYNQHE INQSSLFPFF NDNNPSVYNH PVTQTLQGLD PSFMTFTDCL  60
HGSMDYNTLS RAFDMSCNSP SGHQNHHLST PIDTNLKKQA AMGDSAGTSE NPSTPNSSVS  120
ASSSNEAAAG EEESDKSKKD KQPQGCEEDG DEAKSKKANK PKKKEKRQRE PRFAFLTKSE  180
IDHLEDGYRW RKYGQKAVKN SPYPRSYYRC TSQKCTVKKR VERNFQDPSI VITTYEGQHN  240
HQCPATLRGN AAGMLSPSLL ACASIRPSFP QQLLTQFLPT NNQVDPNSMF YRNLSTQQQF  300
QLPDYGLLQD LVPSFSNRQK P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-261772451078Probable WRKY transcription factor 4
2lex_A1e-261772451078Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163168KEKRQR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023877685.10.0probable WRKY transcription factor 71
SwissprotQ8VWJ21e-58WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A2N9G5S51e-174A0A2N9G5S5_FAGSY; Uncharacterized protein
STRINGVIT_12s0028g00270.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.14e-55WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]