PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01722-augustus-gene-0.33-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 414aa    MW: 45247.9 Da    PI: 6.7026
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01722-augustus-gene-0.33-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.52.7e-28113170260
                                                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                                    +DgynWrKYGqK vkg+ef rsYY+Ct+++C vkk++er++  +++++ tY g+H h+k
  maker-scaffold01722-augustus-gene-0.33-mRNA-1 113 EDGYNWRKYGQKLVKGNEFIRSYYKCTHSRCLVKKQLERTH-GGQIIDATYFGQHVHPK 170
                                                    8***************************************9.***************85 PP

2WRKY107.28e-34288346159
                                                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    ++Dgy+WrKYGqK+vkg+++prsYYrC+ +gCpvkk+ver+++dpkvv++tYeg+H+h+
  maker-scaffold01722-augustus-gene-0.33-mRNA-1 288 VNDGYRWRKYGQKMVKGNPNPRSYYRCSNSGCPVKKHVERASHDPKVVITTYEGQHDHD 346
                                                    58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.987107171IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-24108171IPR003657WRKY domain
SuperFamilySSF1182903.66E-23108171IPR003657WRKY domain
SMARTSM007744.5E-30112170IPR003657WRKY domain
PfamPF031061.0E-21113169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-36274348IPR003657WRKY domain
SuperFamilySSF1182905.75E-30280348IPR003657WRKY domain
PROSITE profilePS5081136.254283348IPR003657WRKY domain
SMARTSM007741.4E-39288347IPR003657WRKY domain
PfamPF031067.1E-27289345IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MISSGECAPD EGASDKMQHR QSSDGGIALD QIPDDGLQAK QSDQEASTPS SIPEKASQAP  60
DAAVQTSQSD QEQSPSSIIS EKGSQARDPS NLASQSGQEG STPPVIREKV VTEDGYNWRK  120
YGQKLVKGNE FIRSYYKCTH SRCLVKKQLE RTHGGQIIDA TYFGQHVHPK PELIVPGSVG  180
LALSVLNEKP NEPSSIGAID KSLVEYGQTP HQMKPVDTSP SRCSTVAVSD DVKGALSQKS  240
RIRNEVVVDD DLDSKRRKKE ECNVAVSVEK PSGEPRSVVQ TLSEVDIVND GYRWRKYGQK  300
MVKGNPNPRS YYRCSNSGCP VKKHVERASH DPKVVITTYE GQHDHDMPPA RIVTHNTAGS  360
NVHTTAHNGE ASTKSEDEEL NGKRSRTKSE MNGKPGIETN INEQQTPNPE PVQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-36111350276WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023916985.10.0WRKY transcription factor 1-like
SwissprotQ9SI376e-87WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A2N9FHX71e-176A0A2N9FHX7_FAGSY; Uncharacterized protein
STRINGXP_008229878.11e-141(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93583343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.27e-92zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]