PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01655-augustus-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 344aa    MW: 38832.5 Da    PI: 6.5129
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01655-augustus-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.32.5e-56161421129
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdeel+++yL +kv + ++++  +i evd++k+ePwdLp ++k +ekewyfF+ r
  maker-scaffold01655-augustus-gene-0.20-mRNA-1  16 LPPGFRFHPTDEELITHYLSPKVLDANFST-VAIGEVDLNKCEPWDLPWRAKMGEKEWYFFCVR 78 
                                                    79*************************999.67***************888999********** PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    d+ky+tg r+nrat++gyWkatgkdke+++ +++lvg+kktLvfykgrapkgek++Wvmheyrl
  maker-scaffold01655-augustus-gene-0.20-mRNA-1  79 DRKYPTGLRTNRATDAGYWKATGKDKEIYK-GKALVGMKKTLVFYKGRAPKGEKSNWVMHEYRL 141
                                                    *****************************9.99******************************8 PP

                                            NAM 129 e 129
                                                    e
  maker-scaffold01655-augustus-gene-0.20-mRNA-1 142 E 142
                                                    5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6312166IPR003441NAC domain
PROSITE profilePS5100559.47716166IPR003441NAC domain
PfamPF023658.5E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MENVSTTAKE DEQIELPPGF RFHPTDEELI THYLSPKVLD ANFSTVAIGE VDLNKCEPWD  60
LPWRAKMGEK EWYFFCVRDR KYPTGLRTNR ATDAGYWKAT GKDKEIYKGK ALVGMKKTLV  120
FYKGRAPKGE KSNWVMHEYR LEGKYSGYNL PKTARNEWVI CRVFNKTSGG KKNHISGLMK  180
LSSYANESCP SLLPPLMDSS PYNSETRTGA GETSHGTCFS NPMEDHKTKE RMVDNFNTGL  240
LAASSSLSPS YISSAPNSDY CTNMGNLQYS DTALMQDQLF RMLFENHAGN MKQNMKAEFS  300
SETGFSADMS SVVSNHDMAR RSFEDQDDPS NSGGPVDIDC LWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-551317214171NO APICAL MERISTEM PROTEIN
1ut4_B7e-551317214171NO APICAL MERISTEM PROTEIN
1ut7_A7e-551317214171NO APICAL MERISTEM PROTEIN
1ut7_B7e-551317214171NO APICAL MERISTEM PROTEIN
3swm_A7e-551317217174NAC domain-containing protein 19
3swm_B7e-551317217174NAC domain-containing protein 19
3swm_C7e-551317217174NAC domain-containing protein 19
3swm_D7e-551317217174NAC domain-containing protein 19
3swp_A7e-551317217174NAC domain-containing protein 19
3swp_B7e-551317217174NAC domain-containing protein 19
3swp_C7e-551317217174NAC domain-containing protein 19
3swp_D7e-551317217174NAC domain-containing protein 19
4dul_A7e-551317214171NAC domain-containing protein 19
4dul_B7e-551317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023887029.10.0NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-135NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2N9GZ150.0A0A2N9GZ15_FAGSY; Uncharacterized protein
STRINGEMJ168141e-174(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-128NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]