PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01532-augustus-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family ARR-B
Protein Properties Length: 701aa    MW: 76189 Da    PI: 5.4202
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01532-augustus-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.61.6e-19213256145
                                        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                                                    kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+
  maker-scaffold01532-augustus-gene-0.20-mRNA-1 213 KPRVVWSVELHRKFVAAVNQL-GLEKAVPKKILDLMDVEGLTREN 256
                                                    79*******************.********************987 PP

2Response_reg85.61.5e-28271351109
                                                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHH CS
                                   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlell 62 
                                                    vl vdD+p+ ++ll ++l+k +y +v++a ++  ale+l+e++  +Dl++ D++mp+mdG++ll
  maker-scaffold01532-augustus-gene-0.20-mRNA-1  27 VLAVDDDPICLKLLDTLLRKCQY-QVTTANQAVIALEMLRENRdkFDLVISDVNMPDMDGFKLL 89 
                                                    799********************.***************999889******************* PP

                                                    HHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
                                   Response_reg  63 keireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                                                    +     e++lp+i+++ah++ +++ + +  Ga d+l Kp+ +eel +
  maker-scaffold01532-augustus-gene-0.20-mRNA-1  90 ELVGL-EMDLPVIMLSAHSDTKLVMKGITHGAVDYLLKPVRIEELKN 135
                                                    87754.558***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.3E-1591701IPR017053Response regulator B-type, plant
SuperFamilySSF521721.85E-3624149IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.3E-4324160No hitNo description
SMARTSM004483.0E-3425137IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.98726141IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.2E-2627135IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.34E-3128141No hitNo description
Gene3DG3DSA:1.10.10.605.5E-20210265IPR009057Homeodomain-like
SuperFamilySSF466892.33E-11211264IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-15213256IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MTVEDQRGGV VSKDVSHYDK FPVGMRVLAV DDDPICLKLL DTLLRKCQYQ VTTANQAVIA  60
LEMLRENRDK FDLVISDVNM PDMDGFKLLE LVGLEMDLPV IMLSAHSDTK LVMKGITHGA  120
VDYLLKPVRI EELKNIWQHV IRKKKIEPKD QNKSPNEDKA RHGNSESGQG ASSLGNADQN  180
GKNSRKRKDQ NEDEEEEGDE NGNDSEDPSS QKKPRVVWSV ELHRKFVAAV NQLGLEKAVP  240
KKILDLMDVE GLTRENKYRL YLKRISSVAT QQANMVAALG GKDSSYLRMA SLDGFGEFRN  300
LAGSGRLSSS TLSSYAPSGM FGRLNSPAGL NIRGITSSGL IQPSSQNLSS SINTFGKLQP  360
TLLPPNQSAG LYQGIPTSLE LNQLQQSKCA TGIGDFDPIK DSTGFTVSGS FPDNRVTVGS  420
SSSLLSRASS SPLMLQGNSQ QTHNRGAFGN QSSLGVASLN PESFDLSIGG SSNFVNHNRS  480
DESWQGVVPL SRFSSNALPL SEPFNHDQMA SNNLGISSTS PHIGNSPLEF PSTNVVSGRL  540
GDSGDVCQEG LIGNVVHNIT YTSKQRWEEY KQDYNPNMNH SFSDINSMVS NNGIVSPLGR  600
SLDQNSAICG RSFDVSLIGQ LNGGALSNAQ HSEFENSAVD AKIKSNEDCL LGQTKSQDGF  660
IQNGYESLDD IMNAMMKREQ NQTVLSDGEF GINAYSLGSC I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-19209266164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023908185.10.0two-component response regulator ARR12-like isoform X1
SwissprotQ6K8X61e-149ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2N9G1Q10.0A0A2N9G1Q1_FAGSY; Two-component response regulator
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]