PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01444-snap-gene-0.26-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Trihelix
Protein Properties Length: 329aa    MW: 36495.9 Da    PI: 9.325
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01444-snap-gene-0.26-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix48.13e-1524801672
                                   trihelix 16 emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72
                                               + e +l+r+k+++p+W++v ++++++g+ rs++qC++kw+nl ++ykk+++ e++ +
  maker-scaffold01444-snap-gene-0.26-mRNA-1 24 SSEVSLGRNKSIEPRWKWVEDYCWRKGCFRSQNQCNDKWDNLMRDYKKVRDYERRIA 80
                                               3444555667******************************************99874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.4E-9477No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MILIDAKKTD DERRTKRSSG GDTSSEVSLG RNKSIEPRWK WVEDYCWRKG CFRSQNQCND  60
KWDNLMRDYK KVRDYERRIA ESGEGTKVER SYWKIERNER KERNLPTNMS PQIYQALVEV  120
VEKKLGANVS QRIVVGTGVP MPVASNPNVG FVMDRPVSLP LVQHHISTTT TTTTTTPPPP  180
TLALPAPPAP TLPPLPSLAA PPALTYSQHM PTVDSDTSEH SDSPAKRRRK GGESGEGTSG  240
TANASSSSHE VGTAISKSAS IIAEALQASE EREERRHREL LSLQERRLEI EESKTEINRQ  300
GINGLVDAIN KLADSIHALA SHKTQSAPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023884946.11e-171uncharacterized protein LOC111997125 isoform X2
TrEMBLA0A2I4HRK31e-137A0A2I4HRK3_JUGRE; uncharacterized protein LOC109020711 isoform X2
STRINGGorai.010G171500.11e-124(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35640.12e-48Trihelix family protein