PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01438-augustus-gene-0.24-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 288aa    MW: 31095.5 Da    PI: 8.2052
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01438-augustus-gene-0.24-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260101.39.2e-324107199
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeeredams 59 
                                                    +C++C+vlr++C+++C ++p++     p++q++++ +++k++G++ +++l++a pe+ r+++++
  maker-scaffold01438-augustus-gene-0.24-mRNA-1   4 SCNGCRVLRKGCSENCSIRPCLqwiksPESQANATVFLAKFYGRAGLMNLINAGPEHLRPAIFR 67 
                                                    6*************************************************************** PP

                                         DUF260  60 slvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                                                    sl+yeA+ r+ +P+yG+vg+++++++ql+q+++e++l ++
  maker-scaffold01438-augustus-gene-0.24-mRNA-1  68 SLLYEACGRIVNPIYGSVGLLWSGSWQLCQAAVEAVLKGS 107
                                                    **********************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381559.0E-931278IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089117.23109IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-254103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MRMSCNGCRV LRKGCSENCS IRPCLQWIKS PESQANATVF LAKFYGRAGL MNLINAGPEH  60
LRPAIFRSLL YEACGRIVNP IYGSVGLLWS GSWQLCQAAV EAVLKGSPIT PITSEAAVTD  120
HGPPLKAYDI RHVSKDENSA ASNDPIRVKT RCRFKRSVVK PKACKAGLNM ENSSEAAREI  180
KPSSGSSTSH ESSLSHQSAF APVEGESKET ESMVSVETAE PESIPKPQPA QESELALELT  240
LGFEPMTSRV NRVVPVKKRK VCVISDDSSG SADIVGACKM ELGLDYPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023928569.10.0LOB domain-containing protein 40-like
SwissprotQ9M8861e-105LBD41_ARATH; LOB domain-containing protein 41
TrEMBLA0A2N9GGK61e-166A0A2N9GGK6_FAGSY; Uncharacterized protein
STRINGEMJ169441e-145(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.17e-96LOB domain-containing protein 41