PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01410-augustus-gene-0.37-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 539aa    MW: 59419.6 Da    PI: 7.3622
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01410-augustus-gene-0.37-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1248.7e-08183245163
                                                    XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                         bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                                    eke +r rr   NRe+Ar   +R++a +eeL++k++ L+ eN+ Lk e e   k++++l++ +
  maker-scaffold01410-augustus-gene-0.37-mRNA-1 183 EKEERRIRRVLANRESARQTIRRRQALCEELTRKAADLQWENENLKREKELALKKYQSLETTN 245
                                                    78999**********************************************99****999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-10183247IPR004827Basic-leucine zipper domain
PfamPF001707.3E-7183245IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.519185248IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.01E-5187242No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-4187242No hitNo description
CDDcd147021.14E-14188239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MAMGSASGCV WRSPLSFSCS SASSTTSSSS NDDVADRMVK IELEAAEALA DLAHLAVSLE  60
SSGGAACDSP GEWGSKGKRA KKRVKSESPP ADSALNNSNP PLVLDSVPAS SDLAEDQTVA  120
SLQQCEKMHT GVFKEPEKDE QDPSKTDSKD EQDSELPKPT PDRTTSYASF GFRKSRRNLT  180
EAEKEERRIR RVLANRESAR QTIRRRQALC EELTRKAADL QWENENLKRE KELALKKYQS  240
LETTNKLLKE QMVKAIKVEV EVTPPEHKSA DIATSTSSSS NCPLFLFNRP PLMPVFWPSI  300
IPSQNPVPSL HGRLSATVIP SNIDMPGTCR PDISQEQDNH IDVNGPRTPF YVLPYPWFFP  360
LPDHGNGVQP HPSIGMENKQ DETSHNNQYS ASSSSNTVVH VENHHCPLPI KVKTEATAST  420
EARPTNDLNK TPVGCPSDGG GQHTVVHSKE MLFTLAPQDC VQPASTVNHE NRLQSDYTLS  480
EKPSKSCHIV TALPEKKQES AIYPNKKLTD AVAAAEARKR RKELTKLKNL NGRQCRMHC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1517522RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023885322.10.0uncharacterized protein LOC111997465 isoform X2
TrEMBLA0A2N9IE480.0A0A2N9IE48_FAGSY; Uncharacterized protein
STRINGXP_006481816.11e-152(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64002834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.13e-65bZIP family protein