PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01305-snap-gene-0.26-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 344aa    MW: 36918 Da    PI: 6.2378
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01305-snap-gene-0.26-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10236294563
                                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                                kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  maker-scaffold01305-snap-gene-0.26-mRNA-1 236 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 294
                                                9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-16232296IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932234297IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11236287No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-10236290No hitNo description
PfamPF001707.9E-9236290IPR004827Basic-leucine zipper domain
CDDcd147032.18E-25237286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MDKDKTLGHG GGFPPPSGRY SGYSPSGSSF NVKPEPSSTS PSFPPLGPGT SSDAGHFGHG  60
MNTDSSHFSH DISRMPDTPR RNLGHRRAHS EILTLPDDIS FDSDLGVVGA GDGPSFSDET  120
EEDLLSMYLD MDKFNSSSAT SAFQMGEPSS AAAATTLAQA SVQTPASGAM TTSAEHVSIG  180
SSERPRVRHQ HSQSMDGSTT IKPEMLVSGS EDLSAADSKK AMSAAKLAEL ALIDPKRAKR  240
IWANRQSAAR SKERKMRYIA ELERKVQTLQ TEATSLSAQL TLLQRDTNGL TAENSELKLR  300
LQTMEQQVHL QDALNDALKE EIQHLKVLTG QAMPNGGPMM NFTS
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023923353.10.0probable transcription factor PosF21
RefseqXP_023923354.10.0probable transcription factor PosF21
SwissprotQ040881e-139POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A2N9GKX60.0A0A2N9GKX6_FAGSY; Uncharacterized protein
STRINGXP_008222595.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-135bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]