PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01193-augustus-gene-0.35-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 165aa    MW: 18393 Da    PI: 6.8947
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01193-augustus-gene-0.35-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.99.9e-4561051100
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    +Ca+Ck+lrr+CakdC++apyfp+++++kfa+vhk+FGasnv+k+l++lp ++r da+sslvye
  maker-scaffold01193-augustus-gene-0.35-mRNA-1   6 PCASCKLLRRRCAKDCIFAPYFPSDDTHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYE 69 
                                                    7*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkee 100
                                                    A+ar+rdPvyG+vg i+ lq+q++ql+ +la++++e
  maker-scaffold01193-augustus-gene-0.35-mRNA-1  70 ANARVRDPVYGCVGAISFLQNQVSQLEMQLAVAQAE 105
                                                    *******************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0215106IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPSD DTHKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLEMQLA VAQAEILCIQ MQQEPNLPTH  120
QIDQVDKSFL LSTNNFDNNN IPQYLSFASS SNVIQDPLKR ESLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298499.11e-103LOB domain protein 12
SwissprotQ8LBW32e-82LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH621e-103B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-83LBD family protein