PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01189-augustus-gene-0.32-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 1880aa    MW: 211320 Da    PI: 4.9813
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01189-augustus-gene-0.32-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13e-182076157
                                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                       Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                                   + kR   t++qle+Le+ ++ + yps++ r+eL++klgL++rq ++WF+ rR k++k
  maker-scaffold01189-augustus-gene-0.32-mRNA-1 20 KTKRKMKTASQLEILEKTYAVEAYPSEALRAELSAKLGLSDRQLQMWFCHRRLKDRK 76
                                                   6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-17876IPR009057Homeodomain-like
SuperFamilySSF466892.61E-151676IPR009057Homeodomain-like
PROSITE profilePS5007116.3251777IPR001356Homeobox domain
SMARTSM003892.5E-161981IPR001356Homeobox domain
PfamPF000466.5E-162076IPR001356Homeobox domain
CDDcd000866.16E-142076No hitNo description
SMARTSM005719.7E-22599658IPR018501DDT domain
PROSITE profilePS5082716.873599658IPR018501DDT domain
PfamPF027911.2E-16600655IPR018501DDT domain
PfamPF050669.4E-16800868IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156128.7E-810171059IPR028942WHIM1 domain
PfamPF156131.7E-1312011273IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1880 aa     Download sequence    Send to blast
MEVAIGSDGE KKKPPEVENK TKRKMKTASQ LEILEKTYAV EAYPSEALRA ELSAKLGLSD  60
RQLQMWFCHR RLKDRKGPSS GKRQLKDSPA REEMVVAEVG NELGSGSGSA SSLLADSRRV  120
VGRPGVGVAV ARMGGDVAVM SRYYEPQQTI AELRAIAFVE AQLGEPLRED GPILGMEFDS  180
LPPDAFGAPI GAVTVGQQKQ SGRPFEPKLY ERPDAKPIKR ENLAEKARKE GEREGTVVLL  240
REFLRGNWLR ESNPSVEERQ REEEEQRMRG KGAGRALHEY QFLPEQPTVR TDAYERVAPS  300
YHYGSPTDGP NARTSSVISG RSFMHGNEQV PSGYSFQGQV PGLNLLPNQG RQGHLLPSVS  360
GEYDTVPRKN AFPNIAMDAH FAAHPITQLE NPFLPSDRRV THDEDVPRME RKRKSEEARI  420
AREVEAHEKR IRKELEKQDI LRRKREEQIR KEMERHDRER RKEEERLLRE KQREEERYQR  480
EQRRELERRE KFLQKESLRA EKLRQKEELR REKEAARLKA ANERAIARRI AKESMELIED  540
ERLELMELAT SSKGLPSIVS LDYDTLQNLE LYRDMLAVFP PKSVCLKRPF TIQPWTDSEE  600
NVGNLLMVWR FLITFADVLG LWPFTLDEFI QAFHDYDPRL LGEINIALLR SIIKDIEDVA  660
RTPATGLGTN QYSAANPGGG HPQIVEGVSD WAVVSTFAPR FGILYQAYAW GFDIRNWQGH  720
LNPLTWPEIL REFALSAGFG PQLKRKNIEQ TYLRDDNEGN DGEDVISNLR NGAAVESAVA  780
IMQERGFSNP RRSRHRLTPG TVKFAAFHVL SLEGSKGLNI LEVAEKIQKS GLRDLTTSKT  840
PEASIAAALS RDSKLFERTA PSTYCVRSAY RKDPADAEAI LSMARERIRI FKSGIVDGED  900
ADDAERDGDS ESDGGEDPEV DDLGTETNSN KEDQNSKETT EFSATPLGNG KGSDDVLETP  960
QVSLGNIDEG LFSMQSGGNG DKDSGLFVAQ SVDASGIGNN MVVGNQEDAD IDESNPGESW  1020
VQGLMEGEYS DLSVEERLSA LVALIGIAIE GNSIHVVLEE RLEAANALKK QMWAEAQLDK  1080
RRMKEEFVLR TTYSSFAGNK AEPNLLTISL AEDRQSPLCT INDKNNETSV APAIEQEQLN  1140
NIQNDQNYLN SLPSEENLQI HDYPTGPDNL PYQQPGYVAE RSRSQLKSYI GHKAEEMYVY  1200
RSLPLGQDRR RNRYWRFITS ASRNDPGCGR IFVELHDGQW RLIDSEEGFD ALLSSLDVRG  1260
VRESHLHTML QKIEMSFKES VRMNMRSAMG RHSGETVKTE AIEMVPGLDF SVGTDSPRST  1320
VCADSDMSET STSFTIELGN NEREKNDALK RYQDFEKWMW KDCVNSAVIF AMKYGKKRDL  1380
QLLSTCDYCH DVYSFEDNHC PSCHKTYSSS RNSNFSEHVS QCEEKPKFDA QNAWHGSLSA  1440
PLRIRLLKVQ LSLIEVSIPL EALQPLWTNS YRKSWGMKLH SSSSAEDLLQ ALTLLESAIK  1500
RDYLSSNFES TTELLGSSNP LGCGTDYSFG PETVLVLPWI PHTTAAVALR LMEFDASISY  1560
MLKQKVDSQK DKGPWVIKLP SKYATVKNSK DDDTGHTPYQ VEHLKEEKWV DSGSGLASSG  1620
RGRGCRGRGR GRIRGGSSQG RVISSRAESG KRTSSTKSDR LGQALGWRGR PRGRGGRRRG  1680
RRSIRSRQRP AKVVVVGGDR DNSKDIILDK SPIGLEWNGD ESMQLPGEDA GSTSSSERSD  1740
YDYENGQATG DEYDDMVMDD FAVGYPGRSD DLLQGTYYNV DVEEEEEEEE EEDEDDVDDN  1800
EGDAEDEQGD LDIDEYINGD SDEEGNGGGD TEQNLDQDQG LFKIRPAPMQ PVDTELIRPL  1860
QSSTVGVWRG GRRKFRHIDD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023901361.10.0homeobox-DDT domain protein RLT2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2I4F9F20.0A0A2I4F9F2_JUGRE; homeobox-DDT domain protein RLT2-like isoform X1
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator