PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01162-augustus-gene-0.26-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 347aa    MW: 38529.4 Da    PI: 6.6512
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01162-augustus-gene-0.26-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.3e-34175233159
                                                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    ldDgy+WrKYGqK vk+s++prsYYrCt++gC vkk+vers++dp++v++tYeg+H+h+
  maker-scaffold01162-augustus-gene-0.26-mRNA-1 175 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTTGCGVKKRVERSSDDPSIVVTTYEGQHTHP 233
                                                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.1E-991341IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.6E-36160235IPR003657WRKY domain
SuperFamilySSF1182902.22E-30167235IPR003657WRKY domain
PROSITE profilePS5081133.166170235IPR003657WRKY domain
SMARTSM007742.9E-41175234IPR003657WRKY domain
PfamPF031068.2E-28176233IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MDNKKEELKF ENSMSNSTFS DEIQGNSFAA LFDMPTCDQG GGGGDQKGFM DLLGISEYGQ  60
SLLDWFPTPS STTTTTTTAT TTATTTTTTV PPQQQPQEQP LPESSEVLNT PATPNSSSIS  120
SSSNEAANEE QIKAGHEEDQ DQEKTKKQLK PKKKNQKRQR EPRFAFMTKS EVDHLDDGYR  180
WRKYGQKAVK NSPYPRSYYR CTTTGCGVKK RVERSSDDPS IVVTTYEGQH THPSPVTPRG  240
SIGLMPEATA AGFGAMASSF VIPQPQYQQQ HPHHHHLQQH PYIYSSQLPL NISTSTTNLN  300
SSSFPSFIQD RHFGTSSSAS LLRDHGLLQD IVPSQMIRKE PKEEYNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-30165235777Probable WRKY transcription factor 4
2lex_A1e-30165235777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4384686e-48KM438468.1 Gossypium aridum WRKY65 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007035842.11e-112WRKY DNA-binding protein 48, putative isoform 1
SwissprotQ9FGZ41e-66WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLA0A061EQ421e-112A0A061EQ42_THECC; WRKY DNA-binding protein 48, putative isoform 1
STRINGVIT_05s0077g00730.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.13e-51WRKY DNA-binding protein 48