PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01128-augustus-gene-0.14-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HSF
Protein Properties Length: 333aa    MW: 37170.1 Da    PI: 5.493
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01128-augustus-gene-0.14-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind111.55.7e-35101022103
                                                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
                                   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 
                                                    F++k++++++d+++++li+w + +nsf+v+d+ +f++++Lp yFkh+nf+SFvRQLn+YgF+kv
  maker-scaffold01128-augustus-gene-0.14-mRNA-1  10 FIMKTFQMVNDPTTDSLITWGRANNSFIVVDPLDFSQRILPAYFKHNNFSSFVRQLNTYGFRKV 73 
                                                    9********************999**************************************** PP

                                                    --SSBTTTTXTTSEEEEESXXXXXXXXXXXXXXXXXXX CS
                                   HSF_DNA-bind  66 kdeekkskskekiweFkhksFkkgkkellekikrkkse 103
                                                    + ++         weF++++F +g+k+ll +i rkk++
  maker-scaffold01128-augustus-gene-0.14-mRNA-1  74 DPDK---------WEFANEWFLRGQKHLLVNIVRKKHN 102
                                                    *999.........*********************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004153.0E-52699IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.77E-32799IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.108.8E-37899IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000564.0E-181033IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004478.3E-301099IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.0E-184860IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS0043404973IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.0E-186173IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006970Biological Processresponse to osmotic stress
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEGYNVIAPF IMKTFQMVND PTTDSLITWG RANNSFIVVD PLDFSQRILP AYFKHNNFSS  60
FVRQLNTYGF RKVDPDKWEF ANEWFLRGQK HLLVNIVRKK HNRSSYTQGK NEELVEDEDL  120
VMEIARLKNE QKAMEDELEG MKKRLEATEK RPQQMMAFLH KVVENPNILP NLMLQRERTR  180
QLISEKKRRL MISSTSSSSS GAVAATTTTT TTTSSIKTEE EDEGTLGVVI SPSPNTGFGI  240
KDFCEQSSPS PETQTPAWLI QSDVMGRSQI GQEPFGCSAM NGFGSNMAVS PLESGVLGYG  300
NSGGQISYFA EMAAGMEVSP PTPYPFSLLG GGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A2e-2519911120Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00379DAPTransfer from AT3G24520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8698196e-51KR869819.1 Vitis pseudoreticulata transcription factor HsfC1a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023929510.10.0heat stress transcription factor C-1
SwissprotQ9LV529e-92HSFC1_ARATH; Heat stress transcription factor C-1
TrEMBLA0A2N9FMD61e-180A0A2N9FMD6_FAGSY; Uncharacterized protein
STRINGcassava4.1_010201m1e-131(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83673038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.14e-88heat shock transcription factor C1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]