PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01092-snap-gene-0.45-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family STAT
Protein Properties Length: 669aa    MW: 75396.6 Da    PI: 5.0799
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01092-snap-gene-0.45-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT160.24.4e-5021531918122
                                       STAT  18 evvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfri 85 
                                                +vvasLlyad+g++ve++ daeapLL+sydG+e++s  rp+k+l+GrasfklkisqLsskc+nrLf+i
  maker-scaffold01092-snap-gene-0.45-mRNA-1 215 KVVASLLYADNGALVENTTDAEAPLLASYDGIEYASCGRPSKMLQGRASFKLKISQLSSKCENRLFCI 282
                                                79****************************************************************** PP

                                       STAT  86 kfeipklkkypfleavskpirCisrsrntrsssltkk 122
                                                +f+++k  +ypf+ea+s pirCisr r++r ssl++k
  maker-scaffold01092-snap-gene-0.45-mRNA-1 283 RFHMLKSGSYPFFEAFSPPIRCISRGRSARGSSLMWK 319
                                                ********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2006.0E-523179IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498991.05E-727179IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.103.2E-7584656IPR000980SH2 domain
SuperFamilySSF555507.0E-9586658IPR000980SH2 domain
PROSITE profilePS500019.885592669IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MVNDIESREY SLLKDFRVEI EEEEEGTTFS LCFWVYLISS STSFPATIIQ QVHSDSVGSA  60
PFLVLDEKKR MMLLPLLLLH KEAPDPENST SWLEAPHASM EIEFPYEKWI HVGCEVSTDF  120
VRLNIDGEIV GEKSLSSLIN KDSPTSSFGK LALANIGGHC DSLQGYVHNV EVLSPALSIK  180
DHWGKDVPLK LSIDNSSASE IEVGDDGVWS IVGGKVVASL LYADNGALVE NTTDAEAPLL  240
ASYDGIEYAS CGRPSKMLQG RASFKLKISQ LSSKCENRLF CIRFHMLKSG SYPFFEAFSP  300
PIRCISRGRS ARGSSLMWKR STSTFHPVNI SQSSRVDEGS LELEHSSIYE ARPYSSSKRV  360
RSGHDKLSTT FKTDPNLERP DEECNSHPWT VNQVENEFGR SLEGRPENLE EADDSLSDSE  420
STEERNSPFK SISSGKSPIS DVTIFKYSLS ALTERSFMLK EIAMSASDNE LSEFAHQVSL  480
YSGCSHHRHQ INIAKRLIEE GTKAWSLISQ NNHYIRWENA VFEIEEYFMK IARCSSRSLT  540
QQDFELLRSI AGSQEYLAQE NFEKMWCWLY PVAFMLSRDW INALWSSTSP KWIEGFITKE  600
EAESSLQGPR GLQEPGTFIL RFPTSRSWPH PDAGNLIVTY VGSDYTLHHR LISLDQIYGY  660
PCKTTNQTQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023876899.10.0SH2 domain-containing protein B-like
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A2I4GXD00.0A0A2I4GXD0_JUGRE; uncharacterized protein LOC109011699
STRINGXP_008226365.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]