PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01061-augustus-gene-0.30-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 188aa    MW: 21742.5 Da    PI: 5.889
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01061-augustus-gene-0.30-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1341e-4181281128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrF Ptdeelvv++L++k++  +++  ++i+++d++ ++Pw+L+ k+ ae ++wyf+s++
  maker-scaffold01061-augustus-gene-0.30-mRNA-1   8 LPPGFRFYPTDEELVVHFLHRKATLLPCHP-DIIPDLDLFPHDPWELDGKALAEGNKWYFYSRK 70 
                                                    79*************************999.99**************977778899******98 PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    ++      ++nr+t++gyWk  g +++v++++g++vg+kk Lvfy g+ap+++kt+W+mheyrl
  maker-scaffold01061-augustus-gene-0.30-mRNA-1  71 AQ------NSNRITSNGYWKPMGIEEPVMNSNGKKVGIKKHLVFYVGEAPSSVKTNWIMHEYRL 128
                                                    76......579***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-504158IPR003441NAC domain
PROSITE profilePS5100547.6668159IPR003441NAC domain
PfamPF023651.6E-249128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MAENNVNLPP GFRFYPTDEE LVVHFLHRKA TLLPCHPDII PDLDLFPHDP WELDGKALAE  60
GNKWYFYSRK AQNSNRITSN GYWKPMGIEE PVMNSNGKKV GIKKHLVFYV GEAPSSVKTN  120
WIMHEYRLSE TSSSSRSSKR RGHPKMDYSK WVICRVYERD EDGDGTELSC LDEVYLSLDD  180
LDEISFPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-46416416173NAC domain-containing protein 19
3swm_B3e-46416416173NAC domain-containing protein 19
3swm_C3e-46416416173NAC domain-containing protein 19
3swm_D3e-46416416173NAC domain-containing protein 19
3swp_A3e-46416416173NAC domain-containing protein 19
3swp_B3e-46416416173NAC domain-containing protein 19
3swp_C3e-46416416173NAC domain-containing protein 19
3swp_D3e-46416416173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023900455.11e-124NAC domain-containing protein 104-like isoform X1
SwissprotQ8GWK69e-80NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A2I4GDM61e-101A0A2I4GDM6_JUGRE; NAC domain-containing protein 104 isoform X1
STRINGXP_010103879.18e-97(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-79xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]