PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00890-augustus-gene-0.33-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 355aa    MW: 40262.4 Da    PI: 8.6906
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00890-augustus-gene-0.33-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.7e-5381431128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdeel+ +yL+k+v++++l++ ++i+evdiyk++Pw+Lp+k++ ++kewyfFs+r
  maker-scaffold00890-augustus-gene-0.33-mRNA-1   8 LPPGFRFHPTDEELILHYLRKRVASTPLPV-SIIAEVDIYKFDPWELPEKAAFGDKEWYFFSPR 70 
                                                    79****************************.89***************988899********** PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlsk.........kgelvglkktLvfykgrapkgekt 119
                                                    d+ky++g r+nra++sgyWkatg+dk++l++         + +++g+kk Lvfykgr pkg kt
  maker-scaffold00890-augustus-gene-0.33-mRNA-1  71 DRKYPNGARPNRAAASGYWKATGTDKTILTSatargggggSLQNIGVKKALVFYKGRPPKGIKT 134
                                                    *****************************987776665544455******************** PP

                                            NAM 120 dWvmheyrl 128
                                                    +W+mheyrl
  maker-scaffold00890-augustus-gene-0.33-mRNA-1 135 NWIMHEYRL 143
                                                    *******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-635174IPR003441NAC domain
PROSITE profilePS5100561.1158174IPR003441NAC domain
PfamPF023651.4E-279143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MKNPQTPLPP GFRFHPTDEE LILHYLRKRV ASTPLPVSII AEVDIYKFDP WELPEKAAFG  60
DKEWYFFSPR DRKYPNGARP NRAAASGYWK ATGTDKTILT SATARGGGGG SLQNIGVKKA  120
LVFYKGRPPK GIKTNWIMHE YRLAELPNYT SKPTKLKDTS MRLDDWVLCR IYKKSNALPP  180
AAASDQDQEE DEQEHVIQDT ILPSLKSPVG HNSTLMPQKS SSFSNLLDAM DYSLLSSLLS  240
DNHCWNTTGF ESTFNNGSLD QPFFNNSIAS GSSSENYMFQ KLPQLNSLAP NMENQLKRQH  300
SNLDHEDMLY PSKKFMNSCS FRNSTNQSDI PQYNILNQSL FNQQLLLSPH LQFQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-72517714168NO APICAL MERISTEM PROTEIN
1ut4_B3e-72517714168NO APICAL MERISTEM PROTEIN
1ut7_A3e-72517714168NO APICAL MERISTEM PROTEIN
1ut7_B3e-72517714168NO APICAL MERISTEM PROTEIN
3swm_A4e-72517717171NAC domain-containing protein 19
3swm_B4e-72517717171NAC domain-containing protein 19
3swm_C4e-72517717171NAC domain-containing protein 19
3swm_D4e-72517717171NAC domain-containing protein 19
3swp_A4e-72517717171NAC domain-containing protein 19
3swp_B4e-72517717171NAC domain-containing protein 19
3swp_C4e-72517717171NAC domain-containing protein 19
3swp_D4e-72517717171NAC domain-containing protein 19
4dul_A3e-72517714168NAC domain-containing protein 19
4dul_B3e-72517714168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023904394.10.0NAC transcription factor 29-like
SwissprotQ84TD61e-109NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A2N9IYH80.0A0A2N9IYH8_FAGSY; Uncharacterized protein
STRINGEOY107311e-163(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-96NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]