PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00806-snap-gene-0.57-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 400aa    MW: 43254.2 Da    PI: 9.9075
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00806-snap-gene-0.57-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42.1e-15322372555
                                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                                +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++
  maker-scaffold00806-snap-gene-0.57-mRNA-1 322 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQAEMMEM 372
                                                79****************************************998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14318383IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.53320371IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-11322371No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-15322371No hitNo description
PfamPF001701.5E-13322374IPR004827Basic-leucine zipper domain
CDDcd147074.56E-27322376No hitNo description
PROSITE patternPS000360325340IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGTNLNFKNS FIMGESEADG NGNGRPPGNF PLTRQSSVYS LTFDEFQNTM GGSLGKDFGT  60
LSQKTVDEVW RDISKDESGN GSSSVPQAQR QQTLGEMTLE EFLVRAGVVR EEIQAQNQLD  120
MVNVKPNTTA AYFGNSGFGY GFQQTGGGGY MENRISEISS NGNGNSNGQF SIQRSQNLPL  180
NVNGVRSNQT QLSRPQQQQQ QQQQQQQQQQ QQQNLQPQIL PKQVPPVAYA MPQLGGPGMM  240
VQSAAAVLQG GGGGGMGMVG LGGGGGGGGV TVAAGSPANQ LSSDGLGKSN GDMSSVSPVP  300
YGYNGGLRGR RCSGAVEKVV ERRQRRMIKN RESAARSRAR KQAYTMELEA EVAKLKEENE  360
ELRKKQAEMM EMQKNQVLEI MNTPRGVKKQ CLRRTQTGPW
Functional Description ? help Back to Top
Source Description
UniProtInvolved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023891238.10.0bZIP transcription factor TRAB1 isoform X2
SwissprotQ9M7Q42e-83AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A2I4DF731e-148A0A2I4DF73_JUGRE; ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
STRINGcassava4.1_007256m1e-124(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.16e-64abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  2. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]