PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00670-augustus-gene-0.38-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SBP
Protein Properties Length: 542aa    MW: 59236.1 Da    PI: 6.6843
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00670-augustus-gene-0.38-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.8e-42179254277
                                                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STT CS
                                            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrr 65 
                                                    Cqv gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+r
  maker-scaffold00670-augustus-gene-0.38-mRNA-1 179 CQVYGCNKDLSSSKDYHKRHKVCEIHSKTAKVIVNGIEQRFCQQCSRFHLLGEFDDGKRSCRKR 242
                                                    **************************************************************** PP

                                                    TT-------S-- CS
                                            SBP  66 Lakhnerrrkkq 77 
                                                    La+hnerrrk+q
  maker-scaffold00670-augustus-gene-0.38-mRNA-1 243 LAGHNERRRKPQ 254
                                                    **********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33172240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.68E-39178254IPR004333Transcription factor, SBP-box
PfamPF031107.7E-32179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MESWNCVSEG KEFESDETIL PTNNSHSRSK NCLLGWELRT PCGFGNDLLV SSQQAVENHR  60
FGELGFPEMI GRQLNHNSTS EVVRSSKVGG EHVGNLVMSM PNGFSGEDDS TSKLTSSVAD  120
SNSRDSSFID LNLGRLADIR DAHNSKFSKG APILLSSSES SSPAKRIRAS GMHSQISFCQ  180
VYGCNKDLSS SKDYHKRHKV CEIHSKTAKV IVNGIEQRFC QQCSRFHLLG EFDDGKRSCR  240
KRLAGHNERR RKPQDIAGSR CQGSPLTTTS FVCQEIPPSG LFQPEKYGTS DWCRHIKLED  300
GSDYRPMTAF PITNGNQNSK SLFPTYNSEK QFPPFHESGA NTTTGSIFSE NAGQYTHDIG  360
GQNSGSRSFF QSTSGSEDFS VFEAASTAQG LSGISDSGCA LSLLSSQSQN SSSHSSGIPM  420
ARPLIMPGSH PHYGMSRVSE KFIGVSSQAS PSGTSNKFIS SEMNSAEENH LGHVFISDSS  480
DAINLEITDG IFQGSNFLHS SDRHSCESGP TIDLLQLSSE LHRVEHQRQS LQVKQENDAQ  540
QT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29174252684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819328e-42LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132668e-42LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023897888.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A2N9ITQ80.0A0A2N9ITQ8_FAGSY; Uncharacterized protein
STRINGXP_008240083.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-47SBP family protein