PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00345-augustus-gene-0.38-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 317aa    MW: 35825.2 Da    PI: 8.4197
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00345-augustus-gene-0.38-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5551311129
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdeel+++yL++kv++ +++  ++i+ vd++k+ePwdLp k++ +ekewyfFs r
  maker-scaffold00345-augustus-gene-0.38-mRNA-1   5 LPPGFRFHPTDEELITYYLTRKVSDLSFTS-KAIAVVDLNKCEPWDLPGKASMGEKEWYFFSMR 67 
                                                    79*************************999.88***************988999********** PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    d+ky+tg r+nrat++gyWk+tgkdke+++  g lvg+kktLvfykgrap+gek++Wvmheyrl
  maker-scaffold00345-augustus-gene-0.38-mRNA-1  68 DRKYPTGLRTNRATEAGYWKTTGKDKEIFR-AGVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRL 130
                                                    ******************************.999*****************************8 PP

                                            NAM 129 e 129
                                                    e
  maker-scaffold00345-augustus-gene-0.38-mRNA-1 131 E 131
                                                    5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-643151IPR003441NAC domain
PROSITE profilePS5100560.4135151IPR003441NAC domain
PfamPF023652.5E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEESLPPGFR FHPTDEELIT YYLTRKVSDL SFTSKAIAVV DLNKCEPWDL PGKASMGEKE  60
WYFFSMRDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRAGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKSSK EEWVVCRVFQ KSAVKKPQQT PSSLPSLESP CDTNSIVNEF  180
GDIELPNLNN IANSSSGFSN ISPHSYNSDN NNINMNMNNW AAVREAAAAS LPSLSWPSSL  240
LSSGLSVNSL LLKALQLRNY QPRDATPTST DYSYMPQGFS HFGSEHLSSN LQASSSKVLE  300
SVQQQQSEQP FNMDSMW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-56415316167NO APICAL MERISTEM PROTEIN
1ut4_B1e-56415316167NO APICAL MERISTEM PROTEIN
1ut7_A1e-56415316167NO APICAL MERISTEM PROTEIN
1ut7_B1e-56415316167NO APICAL MERISTEM PROTEIN
3swm_A2e-56415319170NAC domain-containing protein 19
3swm_B2e-56415319170NAC domain-containing protein 19
3swm_C2e-56415319170NAC domain-containing protein 19
3swm_D2e-56415319170NAC domain-containing protein 19
3swp_A2e-56415319170NAC domain-containing protein 19
3swp_B2e-56415319170NAC domain-containing protein 19
3swp_C2e-56415319170NAC domain-containing protein 19
3swp_D2e-56415319170NAC domain-containing protein 19
4dul_A1e-56415316167NAC domain-containing protein 19
4dul_B1e-56415316167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023926097.10.0NAC domain-containing protein 92
TrEMBLA0A2N9IM070.0A0A2N9IM07_FAGSY; Uncharacterized protein
STRINGPOPTR_0015s03700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-107NAC domain containing protein 58