PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00316-augustus-gene-0.22-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HSF
Protein Properties Length: 357aa    MW: 41539.4 Da    PI: 5.3601
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00316-augustus-gene-0.22-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind114.56.6e-36441352102
                                                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
                                   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 
                                                    Fl+k+y+i+ed+++++++sws+ +nsfvv+d++ fa ++Lp+yFkh+nf+SFvRQLn+YgF+kv
  maker-scaffold00316-augustus-gene-0.22-mRNA-1  44 FLTKTYDIVEDSTTNHVVSWSRGNNSFVVWDPQAFAMTLLPRYFKHNNFSSFVRQLNTYGFRKV 107
                                                    9*************************************************************** PP

                                                    --SSBTTTTXTTSEEEEESXXXXXXXXXXXXXXXXXX CS
                                   HSF_DNA-bind  66 kdeekkskskekiweFkhksFkkgkkellekikrkks 102
                                                    + ++         weF++++F +g+k+ll++i+r+++
  maker-scaffold00316-augustus-gene-0.22-mRNA-1 108 DPDR---------WEFANEWFLRGQKRLLKNIRRRRT 135
                                                    *999.........*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004152.1E-5940133IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.106.4E-3940133IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467855.98E-3640133IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000564.1E-194467IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.4E-3144133IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.1E-198294IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS00434083107IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.1E-1995107IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MNPQGRVKEK FREASSSFSG TPSSSMVHPP QPMEGIHETG PPPFLTKTYD IVEDSTTNHV  60
VSWSRGNNSF VVWDPQAFAM TLLPRYFKHN NFSSFVRQLN TYGFRKVDPD RWEFANEWFL  120
RGQKRLLKNI RRRRTFQLQG SQQALDACVE VGSFGLDEEI DRLKRDKQVL MVELVKLRQQ  180
QQNTRNYIQS MEHRLRKTER KQQQTMNFLA RAMQNPNFLQ QLAQQKDRRK ERQDAITKKR  240
RQPIDQGPSD LEIGVLGQGG EGNFVKVEPH DFGDVSEFEV SELDRLAMDM HGLTESQNNP  300
EEEHIERGGE HESRDMIKDF DEGLWENLLS IEEEIGIMGV GQENDEDLDV LAEYMGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B1e-253513517131Heat shock factor protein 1
5d5v_B1e-253513517131Heat shock factor protein 1
5d5v_D1e-253513517131Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007034864.11e-162Heat stress transcription factor A-6b, putative
SwissprotQ9LUH81e-130HFA6B_ARATH; Heat stress transcription factor A-6b
TrEMBLA0A061EL961e-162A0A061EL96_THECC; Heat stress transcription factor A-6b, putative
STRINGPOPTR_0010s09210.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.11e-127heat shock transcription factor A6B