PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00306-augustus-gene-0.16-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GATA
Protein Properties Length: 357aa    MW: 38875.8 Da    PI: 7.2419
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00306-augustus-gene-0.16-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.41.7e-17243277135
                                           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                                    C +Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  maker-scaffold00306-augustus-gene-0.16-mRNA-1 243 CLHCGSEKTPQWRTGPMGPKTLCNACGVRFKSGRL 277
                                                    99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.7E-8417326IPR016679Transcription factor, GATA, plant
SMARTSM004012.6E-17237287IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-14237274IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.558237273IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-14239300No hitNo description
CDDcd002025.23E-14242289No hitNo description
PROSITE patternPS003440243268IPR000679Zinc finger, GATA-type
PfamPF003203.1E-15243277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEVPEVYMGG YFGGAGVAGQ YSPEKQKTTE HFTVDDLLDF SNEDAVMADG FLDNVTANST  60
DSSTVTAVDS CNSGSRPHFS ACIGSRSFAD SQFSGDLCVP YDDLAELEWL SNFVEDSFSA  120
QQDFQALPYL TGPTTTTTPT TATVSTTQQA SESSSSSETV LPSRNAPFFK PETPLPGKAR  180
SKRSRAAPCD WSTRLVHLAT TPEDQKQQQQ QSILTTKTTT SKKKESSTMD STSSSSSSSG  240
RKCLHCGSEK TPQWRTGPMG PKTLCNACGV RFKSGRLVPE YRPAASPTFV SAKHSNSHRK  300
VLELRRQKDM QRAQHQQFLS QASIFGGGGG GGGDDYLIHH HHHHHHQRSG PDFRHLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023898531.10.0GATA transcription factor 9-like
TrEMBLA0A2N9FQ171e-166A0A2N9FQ17_FAGSY; GATA transcription factor
STRINGGLYMA07G01960.21e-146(Glycine max)
STRINGXP_007135644.11e-146(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-63GATA transcription factor 9