PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00267-snap-gene-1.14-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 1200aa    MW: 134399 Da    PI: 7.7675
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00267-snap-gene-1.14-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.8e-0813492157
                                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                   Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                               +n+yp++e +e+ A+ lgLt +qV+ WF  rR ++k+
  maker-scaffold00267-snap-gene-1.14-mRNA-1 13 ENKYPTKELMEDNAAALGLTYKQVRGWFIERRRRDKR 49
                                               69*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0032654IPR001356Homeobox domain
CDDcd000861.12E-71351No hitNo description
Gene3DG3DSA:1.10.10.608.1E-81353IPR009057Homeodomain-like
PfamPF000464.7E-51349IPR001356Homeobox domain
SuperFamilySSF466891.37E-71354IPR009057Homeodomain-like
PROSITE profilePS5007111.5311350IPR001356Homeobox domain
PROSITE profilePS5082711.219415474IPR018501DDT domain
SMARTSM005718.0E-8415474IPR018501DDT domain
PfamPF027912.4E-8418470IPR018501DDT domain
PfamPF156121.3E-8686726IPR028942WHIM1 domain
PfamPF156133.1E-11820899IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1200 aa     Download sequence    Send to blast
MGKDNHHGVD TTENKYPTKE LMEDNAAALG LTYKQVRGWF IERRRRDKRE NGSIAPSLSA  60
SSKKNPILTT RVGSGTIAAR KVLKGDPLLH KAKASLSSIS NRPSMVETRI PKRKRKPILL  120
QHLFTSDYIL KKVFRKEGPP LGVEFDSLPS RAFCCRTDPK KSHPSCQDNQ GSGKRLKVSE  180
QAILSHQVFN KKSALAKKHG IGKGLMAPAK KHGIGKGLMA PAKKHGIGKG LMTQAKKHGI  240
GKGLMTVWRA TNPDGGDIPT GIDYTDSEVV VSPISTSTAP KKPQHRVKRS QQVPVAKQVK  300
LRNKSQDRRK QSTRRREVEP NQDEHLKQPD IVKCELALEG AISRDYLNHV AMLVDDEELE  360
LQELQAGPNP LRCSDHFAAN GIHGCSLCKD LLAKFPPNSV KMKHPFCTQP WDSSPEIVKK  420
LFKVFHFLYT YAIAVDICSF TLDEFAQSFH DKDSLLLGKI HVALLKLLIS EVEAELSNGY  480
FPPHLSISCN FLALLHSAEN QKVALEFWKR ALNPLTWTEI LRQVLVAAGF GSKQGAMRRE  540
ALNKEMNLMV KYGLRPGTLK CELFKILSEQ GNNGLKVSEL ANTTEELESL ICSSLSSDIT  600
LFEKISSSSY RLRISSVTKE VDEFQSDTED SGSVDDDPND RGLCSDSDDS GCESGNSNSR  660
KFKYMNCHKS QNNMMIVHNE IDESHPGEVW LLGLMEGEYS DLSIEEKLNA LVAITDLLLA  720
GSSFRVEDQT QAIAECAPNI HPYGSGAKLK RSSTKQHCID RPSWGYAGQM HSIKEAYSLF  780
KFYPVDSSVS ISKSYEKERP SGEGENVKEK EVESGLHLMQ SVFLGSDRRY NRYWLFLGPC  840
STLGPCSAYD PGHRRVYFES SEDGHWEVID TVEDLCALLS VLDDRGKREA ILIESLEKRQ  900
AFLCQAMSNK IVKSAGTRHL TQSDQSELDM VREDSCSPVS DVDNLSLTET IKESLPSSGA  960
VVLDVGNKGE EQQERWNRLQ EFDSWIWNSF YSNLNAVKHG KRSYLDSLAR CESCHDLYWR  1020
DEKHCRICHT TFELDFDLEE RYAIHAATCR EKEDSEILFP QHKVLSSQIQ SLKAAIHAIE  1080
SVMPEEALVG AWTKSAHKLW VKRLRRTSSM ADLLQVLADF VGAINEDWLC ECSGQQVSFN  1140
IVEETIASFA SMPQTSSAVA LWLVELDALI APYLEKVRFQ KKPEISTKGR CAPKQSMQLS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14146ERRRRD
24247RRRRDK
34249RRRRDKRE
4110116PKRKRKP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. May prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing. {ECO:0000250|UniProtKB:F4HY56}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023924471.10.0homeobox-DDT domain protein RLT3 isoform X1
RefseqXP_023924472.10.0homeobox-DDT domain protein RLT3 isoform X1
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A2N9IPY10.0A0A2N9IPY1_FAGSY; Uncharacterized protein
STRINGXP_008228086.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61181519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.11e-111Homeodomain-like transcriptional regulator