PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00235-augustus-gene-0.27-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HB-other
Protein Properties Length: 956aa    MW: 106102 Da    PI: 9.2419
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00235-augustus-gene-0.27-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.76e-0669125157
                                                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                                    +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R++ +k
  maker-scaffold00235-augustus-gene-0.27-mRNA-1  69 KRPRDLLNPKAVKYMQSVFSIKDAISKKESREISALFGVTVTQVRDFFASQRTRVRK 125
                                                    799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.78266126IPR001356Homeobox domain
SuperFamilySSF466891.54E-668131IPR009057Homeodomain-like
SMARTSM003895.1E-468130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-669134IPR009057Homeodomain-like
CDDcd000861.96E-469125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MEVSRDDFSE LEIGTSVDSF TRFVDSQREL FHNQIDDLQR IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQSVFSIK DAISKKESRE ISALFGVTVT QVRDFFASQR  120
TRVRKLVRLS REKAMRSSAC KELHDGALIS SDPMIPIDPV PLNSVGPASV EEAPSCSTQD  180
EALPGLDDED KHFVENIFNF MRKEETFSGQ VKLMEWILQI QNSSVLCWYL SNNFLRLVAS  240
SSTWLSQAAV EEQTSILLVI LKVLCHLPLH KALPVHMSAI LQSVNRLRFY RASGVFLCLV  300
TFAFSLSVSL SFLLTLYVVT LWIGIDFESS IGIIEFCLPF YVKLRSDISN RARVLLSRWS  360
KLLARSQAMK NPNGMKSPSD IQNDMMLKQR QVHVFTSYTC KICEIRRHSC SFVWKFREFK  420
LVTETRERRK VQLVEQPGQK MAGRSMQATR SAPLNQGRPM SADDIQKAKM RAQFMQSKYG  480
KNGSSNESKE SKTEGLNKPS TTQASTLNPV YKVPVRPNIE EQKKPVILPT KISSKVEAPL  540
DPKSRMDSKE PLWEKCRRVQ IQWQTPPGTS AFSSCWLFFA ISFYVLFLSA EIRLNDHWSV  600
GGGENSKEVE VQRNRNRREK ETIYQTVQEI PYNPKEPWDM EMDYDDTLTP QVPIEQPPDA  660
DSLETQVATN QVVNNAVSLA TPSSQVSSTA EPDLELLAVL LKNPELVFAL TSGQAGNLSS  720
EETVKLLDMI KAGGAGLAGS FNSGRAEEKV EVSLPSPTPS SNSGTSGWRP EVARNAFMQP  780
SSVANRVAYT SPGVATTSLM LPQATEANLI PPQQSSSMAQ QFAAAMHTYS LPQTTTNIPG  840
RQLPSLHPAR QTPASEMVLT SRNSSSMGAP LHNFSTTAAP SALQIESTSN IKPAHVSVTL  900
NTPGRAHASF PLQPTRSQTH SQSQHRSTIL VGFVNSGGGV GSFRLGMGFG MRTMLE
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023891477.10.0homeobox protein LUMINIDEPENDENS isoform X1
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2I4FUX10.0A0A2I4FUX1_JUGRE; homeobox protein LUMINIDEPENDENS isoform X2
STRINGEOX949880.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-142HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]