PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00136-augustus-gene-0.32-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SBP
Protein Properties Length: 1089aa    MW: 120549 Da    PI: 7.8339
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00136-augustus-gene-0.32-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.2e-41163240178
                                                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-ST CS
                                            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrr 64 
                                                    +Cqv++C++dls+ak+yhrrhkvCevhska+ +lv++++qrfCqqCsrfh lsefDe+krsCrr
  maker-scaffold00136-augustus-gene-0.32-mRNA-1 163 MCQVDNCKEDLSTAKDYHRRHKVCEVHSKATRALVANQMQRFCQQCSRFHPLSEFDEGKRSCRR 226
                                                    6*************************************************************** PP

                                                    TTT-------S--- CS
                                            SBP  65 rLakhnerrrkkqa 78 
                                                    rLa+hn+rrrk+q+
  maker-scaffold00136-augustus-gene-0.32-mRNA-1 227 RLAGHNRRRRKTQP 240
                                                    ***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-35156225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.137161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-37162242IPR004333Transcription factor, SBP-box
PfamPF031105.9E-30164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1089 aa     Download sequence    Send to blast
MEEAGAQVAP PLFIHHHQHQ ALASRYTMAK KRDLPNYQAQ QRFTQPPTGL QNTRDNWNPK  60
AWDWDSVGFV AKPVDAEELL RLGTPAVAAQ MEQKRKEESM ALTVDEEEDE RLRLNLNLWG  120
GLNSVEEPGQ DAAGPVPASR PNKRVRSGSP GGGGGGGGGN YPMCQVDNCK EDLSTAKDYH  180
RRHKVCEVHS KATRALVANQ MQRFCQQCSR FHPLSEFDEG KRSCRRRLAG HNRRRRKTQP  240
EDVTSRLLLP GNRDNGTSAN LDIVNLLTAL ARVQGKNQDK NINCSSVPDR DQLIQILGKI  300
NSLPLPVDLA AKLPNLGSLN RKVPDHNSLE HQNKLNGNPS SPSTMDLLTV LSTTLATSAP  360
DALTMLSQKS SQSSDSEKMT SRDQATGSNL QKRSPLEFPS VGGARSSSSY QSPMEDSDGQ  420
VQEMPVNLPL QLFSSSPEND SPPKLASSRK YFSSDSSNPI EERSPSSSPP AVPKLFPMQH  480
KKETTKPEKM LISGGVKANV VASRARDCNR PFDLFRGSNT GGEAGSFQSF PYQAGYTSSG  540
SDHSPSSLNS DTQDRTGRIL FKLFDKDPSH FPGSLRTQIY NWLSNSPSEM ESYIRPGCVV  600
LSIYVSMSSA SWEQLEQNLL ERVTSLVQSS DCDFWRSGRF IVHAGSQLAS HKDGKIRLCK  660
SWRTWSSPEL ILVSPLAVVG GQETSLLLKG RNLSNHGTKI HCTYMGGYTS KEIKESTYQD  720
TACDEINLVD FKIHNASPGV VGRCFIEVEN GFKGNCFPVI IADSIICKEL RLLESEIDLE  780
TKDCDFILED NSNDFGRPRS REEILHFLNE LGWLFQRKGN SSLLGGPDYS LSRLKFLLTF  840
SVERDCCALV TTLLDMLVER NLDGDELSKE SMETLSEIQL LNRAVKRRCR KMVDVLIHYF  900
IISSNDASKK YIFPPNYTGP GGVTPLHLAA CTSGSDEMID ALTSDPLEIG LSCWNSLLDA  960
TGQSPYAYAM TRSNHSYNKL VARKLADRKN GQVSVTIGNE IEQPQLTMEQ QHKISQFKQG  1020
SRSCARCAVK ATKYDMRIAG SQGLLQRPFI HSMLAIAAVC VCVCVFFRGS PDIGSVAPFK  1080
WENLDYGTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-31154237184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1882887RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018843080.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2N9IR220.0A0A2N9IR22_FAGSY; Uncharacterized protein
STRINGXP_008237887.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]