PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00068-augustus-gene-1.31-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 784aa    MW: 83965.9 Da    PI: 6.0317
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00068-augustus-gene-1.31-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.45.2e-32360416259
                                                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh 
  maker-scaffold00068-augustus-gene-1.31-mRNA-1 360 EDGYNWRKYGQKQVKGSEYPRSYYKCTHSNCPVKKKVERSH-EGHITEIIYKGAHNHL 416
                                                    7****************************************.***************5 PP

2WRKY103.61.1e-32574632159
                                                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                    ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  maker-scaffold00068-augustus-gene-1.31-mRNA-1 574 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 632
                                                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-28358418IPR003657WRKY domain
SuperFamilySSF1182909.02E-25358418IPR003657WRKY domain
SMARTSM007742.4E-35359417IPR003657WRKY domain
PROSITE profilePS5081122.814360418IPR003657WRKY domain
PfamPF031065.5E-25360415IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-37559634IPR003657WRKY domain
SuperFamilySSF1182901.83E-28566634IPR003657WRKY domain
PROSITE profilePS5081138.664569634IPR003657WRKY domain
SMARTSM007741.5E-37574633IPR003657WRKY domain
PfamPF031067.2E-25575632IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
SGGGEAEAEG IPSGCNLRPQ FLLLVVPVLS LCMAGIDDNV AIIGDWVPPS PSPRTFFSAM  60
LGEDIGSRPL VSEPPSSNRS EGLFLGRPPD QMVSGNRAVN NNGTLQGCLS SDKLTEFGSF  120
SEQKSGSRGG LVERMAARAG FNAPRLNTES IRSADLSLSS DNRSPYITIP PGLSPTTLLL  180
DSPVFLSNSL AQPSPTTGKF PFVSNVDSRS LTLMPEAPDK SKDGLFEDIN TSSFAFRPMP  240
EPGTSFFFGT SSKMTPATLP QQSFPRIEVS VQSENSIQSA EPTKVQTQNR SNLHPQADLS  300
RSSTEKDNGA NTISADQRAF DAVGGIVENS PPLDEQPDEE ADQRGNGDPM AAGGGGAPSE  360
DGYNWRKYGQ KQVKGSEYPR SYYKCTHSNC PVKKKVERSH EGHITEIIYK GAHNHLKPPP  420
NRRSAIGSGN PLADMQLDIP EQAVPQSAAD GEPVWASTQK GVVAGASDWR HDNLEVTSSA  480
SVGPEYQSAS VQAQNGTHFE SGDAVDASST FSNDEDEDDR GTHGSVSLGY DGEGDESESK  540
RRKIEAYATE MSGATRAIRE PRVVVQTTSE VDILDDGYRW RKYGQKVVKG NPNPRSYYKC  600
TSAGCTVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS HVNSGTSSAV PAQSSAAAAV  660
QAHVHRPEPS QVHPGMARFE RPASLGSFSL PARQQMGPSH GYSFGMNQPG LANLAMAGLG  720
PGQAKLPVMS VHPYMAQQQR QVNEMGFVLP KGEPKVEPMS EPGLNLSNGS SVYQQFMSRL  780
PLGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36360635878Probable WRKY transcription factor 4
2lex_A1e-36360635878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023887809.10.0probable WRKY transcription factor 2
RefseqXP_023887810.10.0probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A2N9J9N80.0A0A2N9J9N8_FAGSY; Uncharacterized protein
STRINGXP_008246415.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95243443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]