PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00058-snap-gene-0.45-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WRKY
Protein Properties Length: 521aa    MW: 56900.7 Da    PI: 4.6662
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00058-snap-gene-0.45-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.81.5e-25221277259
                                                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+Y+++H h+
  maker-scaffold00058-snap-gene-0.45-mRNA-1 221 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSDCCAKK-IECSDHSGRVIEIVYKSQHSHD 277
                                                7********************************98.*********************7 PP

2WRKY97.59e-31384440359
                                                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                                Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+
  maker-scaffold00058-snap-gene-0.45-mRNA-1 384 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNASAVIITYKGVHDHD 440
                                                9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081118.636215279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-21217279IPR003657WRKY domain
SuperFamilySSF1182906.67E-20218279IPR003657WRKY domain
SMARTSM007742.5E-24220278IPR003657WRKY domain
PfamPF031061.3E-17222277IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-32367442IPR003657WRKY domain
PROSITE profilePS5081131.732377442IPR003657WRKY domain
SuperFamilySSF1182904.84E-27378442IPR003657WRKY domain
SMARTSM007741.8E-35382441IPR003657WRKY domain
PfamPF031061.1E-23384439IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MAGNESFEAL RVENSKSRER EVVVEEEEEE EYEEDPEEEE VEESEEEEEE EEEEDEGDER  60
EEESLGELEL SELRSSAPLG EPKLGDSQFE TLAPSSSSLQ SSQNDHCAGL AVKSTSQSLG  120
EAEVQDQVGV SQQAALASAT AQLVDAQTQN QYQVAICPTS PSELSPTSVT QSISSLPSPT  180
LLEQRLSPVK VNDECTPKTD LQVSSDLKPI SSVPAVKTPS SDGYNWRKYG QKQVKSPKGS  240
RSYYKCTFSD CCAKKIECSD HSGRVIEIVY KSQHSHDPPR KFNCTKENKL ASSAEIVVAN  300
SVTEHPIQML NKSEPPTASK ETIQETPLIS ERKRQNSSDS NGNCETKIKE EHKSNLANSG  360
STIKPGKKPK FVVHAAGDVG ISGDGYRWRK YGQKMVKGNP HPRNYYRCTS AGCPVRKHIE  420
TAVDNASAVI ITYKGVHDHD MPVPKKRHGP PSAPLVAAAA PASMNNLQSK KTDALQNQAS  480
STQWSVDTEG ELTGEAMELG GEKAIESART LLSIGFEIKP C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-25373442877Probable WRKY transcription factor 4
2lex_A9e-25373442877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204099.10.0hypothetical protein PRUPE_ppa004042mg
SwissprotP595831e-128WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM5W7R30.0M5W7R3_PRUPE; Uncharacterized protein
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-118WRKY DNA-binding protein 32