PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00016-augustus-gene-2.24-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YC
Protein Properties Length: 262aa    MW: 29059.9 Da    PI: 6.3399
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00016-augustus-gene-2.24-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC177.81e-55811841101
                                          NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlr 61 
                                                    ql++fw++q   iek+tdfknh+lPlarikki+kadedv+misaeaPv++++ace+fileltlr
  maker-scaffold00016-augustus-gene-2.24-mRNA-1  81 QLQTFWANQyqeIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLR 144
                                                    89******99999*************************************************** PP

                                          NF-YC  62 swlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                                                    sw+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l
  maker-scaffold00016-augustus-gene-2.24-mRNA-1 145 SWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 184
                                                    *************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.7E-3371175IPR009072Histone-fold
PfamPF008081.6E-21103166IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.0E-37104181IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDQQGHSQAP SMGVIGSGAQ LPYATNPYQT GQMTGAPAHG SVVTSVGAIQ STSQPSGAQL  60
AQHQLAYQHI HQQQQQQLQQ QLQTFWANQY QEIEKVTDFK NHSLPLARIK KIMKADEDVR  120
MISAEAPVIF ARACEMFILE LTLRSWNHTE ENKRRTLQKN DIAAAITRTD IFDFLVDIVP  180
REDLKDEVLA SIPRGTMPVG GPADALPYCY MPSQHAPQVG TPGMIMGKPV MDPAMYAQQS  240
HAYMAQQMWP QAPDQQPSPS DH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C2e-41671814119HapE
4g92_C2e-41671814119HapE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153159RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015875195.11e-163PREDICTED: nuclear transcription factor Y subunit C-3-like
RefseqXP_015875194.11e-163PREDICTED: nuclear transcription factor Y subunit C-3-like
RefseqXP_015875193.11e-163PREDICTED: nuclear transcription factor Y subunit C-3-like
SwissprotQ8L4B21e-91NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLG7KYQ41e-159G7KYQ4_MEDTR; Nuclear transcription factor Y protein
TrEMBLI3TAX91e-159I3TAX9_MEDTR; Nuclear transcription factor Y subunit C2
STRINGGLYMA19G42460.11e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.41e-87nuclear factor Y, subunit C9