PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00002-augustus-gene-1.34-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 288aa    MW: 32858.3 Da    PI: 7.0978
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00002-augustus-gene-1.34-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.6e-5371311128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 
                                                    lppGfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++Pw+Lp k+  +ekewyfFs+r
  maker-scaffold00002-augustus-gene-1.34-mRNA-1   7 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWELPGKALYGEKEWYFFSPR 69 
                                                    79**************************99.88***************7777789********* PP

                                            NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                    d+ky++g+r+nra+ +gyWkatg dk++ +   ++vg+kk Lvfy g+ap+gekt+W+mheyrl
  maker-scaffold00002-augustus-gene-1.34-mRNA-1  70 DRKYPNGSRPNRAAGTGYWKATGADKPIGN--PKAVGIKKALVFYAGKAPRGEKTNWIMHEYRL 131
                                                    ****************************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-634157IPR003441NAC domain
PROSITE profilePS5100561.2417157IPR003441NAC domain
PfamPF023659.4E-288131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSTELVLPPG FRFHPTDEEL VMHYLCRKCA SQPIAVPIIA EIDLYKYDPW ELPGKALYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGNP KAVGIKKALV FYAGKAPRGE  120
KTNWIMHEYR LADVDRSARK KNSLRLDDWV LCRIYNKKGT LEKQEVLNAN NKMHNNSEME  180
DKKPEILNTS ALPPPVAPPA ATANEYAYFD TSDSVPRLHT DSSCSEHVVS PEFTCEVQSE  240
PKYWEKNLDF PFNYMDAMDN GFVSQFQGGS SSQMSPLQDM FMYLPKTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-81216310174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023924292.10.0NAC domain-containing protein 2-like
SwissprotQ390131e-145NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A2N9ELS70.0A0A2N9ELS7_FAGSY; Uncharacterized protein
STRINGXP_010095416.11e-169(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-137NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]