PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold13176-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 152aa    MW: 17476.1 Da    PI: 8.7936
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold13176-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.76e-368103196
                                                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57 
                                                           aCaaCk++rrkCa+dC+lap fpae+ ++f+++h+lFG+sn++k+lk +++ +re+a
  augustus_masked-scaffold13176-abinit-gene-0.0-mRNA-1   8 ACAACKYQRRKCANDCPLAPFFPAEEFESFQYAHRLFGVSNIMKILKPVHPADREKA 64 
                                                           7******************************************************** PP

                                                DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                                                           ++s+ ye+e+++  P  G++g++++lq +++++  el++
  augustus_masked-scaffold13176-abinit-gene-0.0-mRNA-1  65 TRSVKYESEMWTTFPNTGCYGIVQQLQLRIQEATGELQS 103
                                                           *******************************99988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3577108IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-348103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MTLTTKSACA ACKYQRRKCA NDCPLAPFFP AEEFESFQYA HRLFGVSNIM KILKPVHPAD  60
REKATRSVKY ESEMWTTFPN TGCYGIVQQL QLRIQEATGE LQSLLPDIVR IYMDRIKKHH  120
SPPSQLPLGI TYFKSQCQHQ QKVAEDYIST SQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2121105113LOB family transfactor Ramosa2.1
5ly0_B1e-2121105113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023885477.13e-86LOB domain-containing protein 22-like
TrEMBLA0A498J2U51e-36A0A498J2U5_MALDO; Uncharacterized protein
STRINGXP_008348215.12e-37(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-27LOB domain-containing protein 22