PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GRAS
Protein Properties Length: 487aa    MW: 54213.6 Da    PI: 6.5749
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS114.11.8e-351663362158
                                                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs 58 
                                                           ++lL  cAea++++d++++q+lL  l+el+  +gd+++ la +  eAL +++++  +
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 166 EQLLNPCAEAITKNDMSRVQHLLYVLKELRDAKGDANHCLAWHGFEALTKHISS-FP 221
                                                           689**************************************************9.33 PP

                                                  GRAS  59 elykalppsetsekn........sseelaalkl....fsevsPilkfshltaNqaIl 103
                                                           + +++ ++s++s  +        ++++++        f+evsP+l f + +aN  Il
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 222 SSAASSSSSTSSI-DpivltfasTDSRIFQ--QpllkFNEVSPWLAFPNNIANASIL 275
                                                           3332223333322.2344555433333333..14589******************** PP

                                                  GRAS 104 eavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.s 154
                                                           + +++e      +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT +++ +++ +
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 276 QILAQEpnrsGNLHILDIGVSHGVQWPTLLEALSRRPgGPPPLVRITIIAQTTENdQ 332
                                                           *****99888889************************55566********9776655 PP

                                                  GRAS 155 keel 158
                                                           ++e+
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 333 NKEM 336
                                                           5554 PP

2GRAS44.23.1e-14395479287374
                                                  GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                                                           r+l++ e+ ++++++g +    +e  ekW er++ +GF   +++e+a +  ++llrk
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 395 RKLMEGEAAKALSNKGVM----NEGNEKWCERMRGVGFVGEAFREDAIDGGRALLRK 447
                                                           678888899999999998....9999******************************* PP

                                                  GRAS 344 vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                           ++ ++++rvee+++++ l Wk++p+ ++S W+
  augustus_masked-scaffold12546-abinit-gene-0.1-mRNA-1 448 YDsNWEMRVEERDACVGLWWKGQPVSFCSLWK 479
                                                           **9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098521.358139487IPR005202Transcription factor GRAS
PfamPF035146.1E-33166336IPR005202Transcription factor GRAS
PfamPF035141.1E-11395479IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MTIGEPETNH PTSDQIMDWL NTGTIFPAFM DDSYNSGWWD ESQNISQALI DTNSTLTYLT  60
NDTANITTST QSDYASITNH PSPSDSSKKR KTASDPLPKP SSNHQRKNHS RRISLQAESG  120
DAAAAVDQEV VTVKKSVGNK RSSNKSTGNN CHNGNNNKKK EGRWAEQLLN PCAEAITKND  180
MSRVQHLLYV LKELRDAKGD ANHCLAWHGF EALTKHISSF PSSAASSSSS TSSIDPIVLT  240
FASTDSRIFQ QPLLKFNEVS PWLAFPNNIA NASILQILAQ EPNRSGNLHI LDIGVSHGVQ  300
WPTLLEALSR RPGGPPPLVR ITIIAQTTEN DQNKEMSFTI GPPVINTVFD ETLIICAQFR  360
LHGLDHNDPD ERTEFLRVLR SMEPKAFKGR ECDKRKLMEG EAAKALSNKG VMNEGNEKWC  420
ERMRGVGFVG EAFREDAIDG GRALLRKYDS NWEMRVEERD ACVGLWWKGQ PVSFCSLWKL  480
DTKDIDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-1616233384246Protein SHORT-ROOT
5b3h_B2e-1616233330192Protein SHORT-ROOT
5b3h_E2e-1616233330192Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023914024.10.0LOW QUALITY PROTEIN: nodulation-signaling pathway 1 protein
SwissprotQ4VYC81e-164NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2I4FTT10.0A0A2I4FTT1_JUGRE; nodulation-signaling pathway 1 protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
STRINGXP_010086812.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-112GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]