PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold10669-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 334aa    MW: 37481.4 Da    PI: 7.774
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold10669-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52151412128
                                                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew 58 
                                                            pGfrFhPtdeelv +yLk+kv+++ l++ e ik+vdiyk++PwdLpk ++++ekew
  augustus_masked-scaffold10669-abinit-gene-0.0-mRNA-1  15 LPGFRFHPTDEELVGFYLKRKVQQRALPI-ELIKHVDIYKYDPWDLPKLAASGEKEW 70 
                                                           69***************************.89***************8888899*** PP

                                                   NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrap 114
                                                           yf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +++ +glkk+Lvfy+gra 
  augustus_masked-scaffold10669-abinit-gene-0.0-mRNA-1  71 YFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSdSTKCIGLKKSLVFYRGRAA 127
                                                           ************************************955666*************** PP

                                                   NAM 115 kgektdWvmheyrl 128
                                                           kg ktdW+mhe+rl
  augustus_masked-scaffold10669-abinit-gene-0.0-mRNA-1 128 KGIKTDWMMHEFRL 141
                                                           ************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5413144IPR003441NAC domain
PROSITE profilePS5100551.64514156IPR003441NAC domain
PfamPF023657.3E-2616141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDEKNDVDKV DDVILPGFRF HPTDEELVGF YLKRKVQQRA LPIELIKHVD IYKYDPWDLP  60
KLAASGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSDST KCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSLTESAPP KKLLDKNIPA NFCSTNGLQQ APTSSFSAFD  180
IPSYKPINPT VYKPSLFPSS NGDLQNGFMF SPLEVSGPMK CAVDTASMLL NPALIGDVSN  240
ASRTTDFEGP PQQFSGFSIS LPQEMQENLG TGEDVSGLRK NQGAALNNQW ETIQSIGFPF  300
NLPSNDAWRP NLPWDSPPCP SEMSTNYSTN KCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-501614117140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023928869.10.0protein FEZ-like
TrEMBLA0A2N9FZV10.0A0A2N9FZV1_FAGSY; Uncharacterized protein
STRINGcassava4.1_021102m1e-174(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-88NAC domain containing protein 94